StarFunc result for job id Q969T9

User Input

>input (261 residues)
MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFL
SKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAI
EFGQRMLQVASQASRGEVPSGAYGYSYMPSGAYVYPPPVANGMYPCPPGYPYPPPPPEFY
PGPPMMDGAMGYVQPPPPPYPGPMEPPVSGPDVPSTPAAEAKAAEAAASAYYNPGNPHNV
YMPTSQPPPPPYYPPEDKKTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R478	0.583	0.581	1.724E-40	262	0.962	0.958	Q8R478.pdb.gz	WBP2_RAT WW domain-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Wbp2 PE=1 SV=1
2	AFDB:Q6ICG8	0.524	0.447	1.619E-18	309	0.387	0.327	Q6ICG8.pdb.gz	WBP2L_HUMAN Postacrosomal sheath WW domain-binding protein OS=Homo sapiens OX=9606 GN=WBP2NL PE=1 SV=1
3	AFDB:A3KFF6	0.510	0.427	7.362E-18	313	0.429	0.358	A3KFF6.pdb.gz	WBP2L_BOVIN Postacrosomal sheath WW domain-binding protein OS=Bos taurus OX=9913 GN=WBP2NL PE=2 SV=1
4	AFDB:Q9VU19	0.510	0.353	1.357E-15	384	0.429	0.292	Q9VU19.pdb.gz	Q9VU19_DROME WW domain binding protein 2, isoform E OS=Drosophila melanogaster OX=7227 GN=Wbp2 PE=1 SV=3
5	AFDB:Q18966	0.490	0.543	2.003E-14	235	0.218	0.243	Q18966.pdb.gz	Q18966_CAEEL GRAM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=wbp-2 PE=1 SV=1
6	AFDB:O14032	0.425	0.614	5.766E-11	174	0.172	0.259	O14032.pdb.gz	YEMB_SCHPO UPF0664 stress-induced protein C29B12.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC29B12.11c PE=2 SV=1
7	PDB:5yqrA	0.299	0.292	4.557E-5	268	0.061	0.060	5yqrA.pdb.gz
8	PDB:1lw3A	0.342	0.183	9.449E-5	513	0.069	0.035	1lw3A.pdb.gz
9	PDB:6xtbE	0.316	0.346	2.901E-4	235	0.061	0.068	6xtbE.pdb.gz
10	AFDB:Q45GQ7	0.274	0.217	3.608E-4	349	0.153	0.115	Q45GQ7.pdb.gz	POHS1_ARATH Protein POOR HOMOLOGOUS SYNAPSIS 1 OS=Arabidopsis thaliana OX=3702 GN=PHS1 PE=1 SV=1
11	AFDB:Q06321	0.331	0.080	3.817E-4	1198	0.057	0.013	Q06321.pdb.gz	ATG26_YEAST Sterol 3-beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG26 PE=1 SV=1
12	AFDB:E7F6T8	0.325	0.104	5.652E-4	937	0.119	0.033	E7F6T8.pdb.gz	UBP37_DANRE Ubiquitin carboxyl-terminal hydrolase 37 OS=Danio rerio OX=7955 GN=usp37 PE=2 SV=1
13	AFDB:Q8IVF5	0.276	0.054	7.074E-4	1701	0.142	0.022	Q8IVF5.pdb.gz	TIAM2_HUMAN Rho guanine nucleotide exchange factor TIAM2 OS=Homo sapiens OX=9606 GN=TIAM2 PE=2 SV=4
14	PDB:3m1iB	0.331	0.601	2.586E-3	131	0.069	0.137	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
15	PDB:7r04B	0.283	0.038	2.586E-3	2229	0.034	0.004	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
16	PDB:1k5dB	0.335	0.549	2.893E-3	146	0.069	0.123	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
17	PDB:7mp5A	0.294	0.053	3.060E-3	1629	0.031	0.005	7mp5A.pdb.gz
18	PDB:7r03B	0.279	0.037	3.621E-3	2246	0.034	0.004	7r03B.pdb.gz
19	PDB:7nkyQ	0.259	0.178	3.830E-3	404	0.057	0.037	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
20	PDB:3pvuA	0.279	0.129	4.531E-3	609	0.054	0.023	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	K7EMC9	0.0	504	257	0.985	1.000	K7EMC9_HUMAN WW domain binding protein 2 OS=Homo sapiens OX=9606 GN=WBP2 PE=1 SV=1
2	P97765	0.0	505	261	0.969	0.969	WBP2_MOUSE WW domain-binding protein 2 OS=Mus musculus OX=10090 GN=Wbp2 PE=1 SV=1
3	Q969T9	0.0	518	261	1.000	1.000	WBP2_HUMAN WW domain-binding protein 2 OS=Homo sapiens OX=9606 GN=WBP2 PE=1 SV=1
4	A6NG10	1.93e-170	471	239	0.916	1.000	A6NG10_HUMAN WW domain binding protein 2 OS=Homo sapiens OX=9606 GN=WBP2 PE=1 SV=2
5	Q8R478	5.73e-130	370	262	0.962	0.958	WBP2_RAT WW domain-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Wbp2 PE=1 SV=1
6	K7EIK1	8.79e-106	306	205	0.609	0.776	K7EIK1_HUMAN WW domain binding protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=WBP2 PE=1 SV=1
7	A3KFF6	1.46e-46	159	313	0.337	0.281	WBP2L_BOVIN Postacrosomal sheath WW domain-binding protein OS=Bos taurus OX=9913 GN=WBP2NL PE=2 SV=1
8	Q6ICG8	1.34e-37	136	309	0.261	0.220	WBP2L_HUMAN Postacrosomal sheath WW domain-binding protein OS=Homo sapiens OX=9606 GN=WBP2NL PE=1 SV=1
9	Q9VU19	4.54e-32	123	384	0.264	0.180	Q9VU19_DROME WW domain binding protein 2, isoform E OS=Drosophila melanogaster OX=7227 GN=Wbp2 PE=1 SV=3
10	Q18966	3.83e-30	114	235	0.284	0.315	Q18966_CAEEL GRAM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=wbp-2 PE=1 SV=1
11	O14032	4.30e-09	56.6	174	0.165	0.247	YEMB_SCHPO UPF0664 stress-induced protein C29B12.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC29B12.11c PE=2 SV=1
12	Q9LYG2	3.94e-04	42.7	207	0.103	0.130	Q9LYG2_ARATH Classical AGP protein OS=Arabidopsis thaliana OX=3702 GN=At5g11680 PE=1 SV=1
13	Q7Z7A1	0.46	34.3	2325	0.100	0.011	CNTRL_HUMAN Centriolin OS=Homo sapiens OX=9606 GN=CNTRL PE=1 SV=2
14	Q9WU78	8.6	30.4	869	0.080	0.024	PDC6I_MOUSE Programmed cell death 6-interacting protein OS=Mus musculus OX=10090 GN=Pdcd6ip PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02893 GRAM	5.2e-12	57.1	GRAM domain
2	PF11605 Vps36_ESCRT-II	0.42	22.2	Vacuolar protein sorting protein 36 Vps36

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000467579

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478927	0.995	Transcriptional coactivator YAP1
2	9606.ENSP00000457230	0.983	WW domain-containing oxidoreductase
3	9606.ENSP00000233615	0.947	WW domain binding protein 1
4	9606.ENSP00000352069	0.910	NEDD4-like E3 ubiquitin-protein ligase WWP2
5	9606.ENSP00000424827	0.888	E3 ubiquitin-protein ligase NEDD4
6	9606.ENSP00000427793	0.858	NEDD4-like E3 ubiquitin-protein ligase WWP1
7	9606.ENSP00000480499	0.848	E3 ubiquitin-protein ligase Itchy homolog
8	9606.ENSP00000419465	0.792	WW domain-containing transcription regulator protein 1
9	9606.ENSP00000263334	0.774	Paired box protein Pax-8
10	9606.ENSP00000479130	0.730	Acyl-CoA synthetase family member 3, mitochondrial
11	9606.ENSP00000232165	0.699	Ubiquitin-protein ligase E3A
12	9606.ENSP00000276420	0.675	Docking protein 2
13	9606.ENSP00000378624	0.674	Probable E3 ubiquitin-protein ligase HERC4
14	9606.ENSP00000233154	0.667	Cytoplasmic protein NCK2
15	9606.ENSP00000369756	0.667	Receptor-type tyrosine-protein phosphatase alpha
16	9606.ENSP00000427015	0.650	Ribosomal protein S6 kinase alpha-2
17	9606.ENSP00000222254	0.642	Phosphatidylinositol 3-kinase regulatory subunit beta
18	9606.ENSP00000266505	0.639	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1
19	9606.ENSP00000435233	0.623	Transcriptional enhancer factor TEF-1
20	9606.ENSP00000405330	0.622	Estrogen receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.405	organic cyclic compound binding
GO:1901363	0.331	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0030518	0.992	intracellular steroid hormone receptor signaling pathway
GO:0034502	0.991	protein localization to chromosome
GO:0048522	0.989	positive regulation of cellular process
GO:0031056	0.989	regulation of histone modification
GO:0031401	0.989	positive regulation of protein modification process
GO:0009966	0.988	regulation of signal transduction
GO:0010628	0.988	positive regulation of gene expression
GO:0033143	0.983	regulation of intracellular steroid hormone receptor signaling pathway
GO:0071168	0.977	protein localization to chromatin
GO:2000756	0.977	regulation of peptidyl-lysine acetylation
GO:0040029	0.975	epigenetic regulation of gene expression
GO:0045944	0.975	positive regulation of transcription by RNA polymerase II
GO:0031058	0.969	positive regulation of histone modification
GO:0045815	0.961	transcription initiation-coupled chromatin remodeling
GO:0035065	0.958	regulation of histone acetylation
GO:0071391	0.944	cellular response to estrogen stimulus
GO:1901985	0.938	positive regulation of protein acetylation
GO:1901700	0.898	response to oxygen-containing compound
GO:2000758	0.827	positive regulation of peptidyl-lysine acetylation
GO:0032570	0.617	response to progesterone
GO:0048584	0.502	positive regulation of response to stimulus
GO:0009967	0.491	positive regulation of signal transduction
GO:0051234	0.449	establishment of localization
GO:0048519	0.339	negative regulation of biological process
GO:0072594	0.315	establishment of protein localization to organelle
GO:0071704	0.305	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]