StarFunc result for job id Q969V5

User Input

>input (352 residues)
MESGGRPSLCQFILLGTTSVVTAALYSVYRQKARVSQELKGAKKVHLGEDLKSILSEAPG
KCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQR
TNTVPFDLVPHEDGVDVAVRVLKPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPK
GIQETEEMLKVGATLTGVGELVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRLW
KVLALVFGFATCATLFFILRKQYLQRQERLRLKQMQEEFQEHEAQLLSRAKPEDRESLKS
ACVVCLSSFKSCVFLECGHVCSCTECYRALPEPKKCPICRQAITRVIPLYNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969V5	1.000	1.000	1.013E-71	352	1.000	1.000	Q969V5.pdb.gz	MUL1_HUMAN Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Homo sapiens OX=9606 GN=MUL1 PE=1 SV=1
2	AFDB:Q8VCM5	0.968	0.968	7.617E-67	352	0.898	0.898	Q8VCM5.pdb.gz	MUL1_MOUSE Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Mus musculus OX=10090 GN=Mul1 PE=1 SV=2
3	AFDB:Q9VZJ9	0.712	0.738	2.510E-35	338	0.278	0.290	Q9VZJ9.pdb.gz	MUL1_DROME Mitochondrial E3 ubiquitin protein ligase 1 OS=Drosophila melanogaster OX=7227 GN=Mul1 PE=1 SV=1
4	AFDB:Q8L7N4	0.607	0.620	8.955E-29	343	0.256	0.262	Q8L7N4.pdb.gz	SP1_ARATH E3 ubiquitin-protein ligase SP1 OS=Arabidopsis thaliana OX=3702 GN=SP1 PE=1 SV=1
5	AFDB:Q9SYH3	0.587	0.545	9.426E-26	383	0.233	0.214	Q9SYH3.pdb.gz	SPL2P_ARATH E3 ubiquitin-protein ligase SPL2 OS=Arabidopsis thaliana OX=3702 GN=SPL2 PE=2 SV=1
6	AFDB:Q94HV7	0.470	0.487	1.191E-25	338	0.239	0.249	Q94HV7.pdb.gz	SPL1P_ARATH E3 ubiquitin-protein ligase SPL1 OS=Arabidopsis thaliana OX=3702 GN=SPL1 PE=2 SV=1
7	AFDB:Q9FZ45	0.352	0.272	1.755E-8	474	0.082	0.061	Q9FZ45.pdb.gz	Y1686_ARATH Uncharacterized membrane protein At1g16860 OS=Arabidopsis thaliana OX=3702 GN=At1g16860 PE=1 SV=1
8	AFDB:Q9VSB9	0.369	0.351	1.183E-6	376	0.102	0.096	Q9VSB9.pdb.gz	TMM43_DROME Transmembrane protein 43 homolog OS=Drosophila melanogaster OX=7227 GN=CG8111 PE=2 SV=1
9	AFDB:F4IS08	0.162	0.129	1.743E-5	447	0.142	0.112	F4IS08.pdb.gz	F4IS08_ARATH RING/U-box superfamily protein OS=Arabidopsis thaliana OX=3702 GN=APD1 PE=1 SV=1
10	AFDB:B3H754	0.168	0.152	4.710E-5	404	0.119	0.104	B3H754.pdb.gz	APD3_ARATH E3 ubiquitin-protein ligase APD3 OS=Arabidopsis thaliana OX=3702 GN=APD3 PE=2 SV=1
11	PDB:5wj9A	0.133	0.107	2.140E-2	479	0.102	0.075	5wj9A.pdb.gz	Human TRPML1 channel structures in open and closed conformations.
12	PDB:6wgg6	0.172	0.112	2.867E-2	576	0.051	0.031	6wgg6.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
13	PDB:6w6wC	0.182	0.196	3.223E-2	323	0.043	0.046	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
14	PDB:7pmk5	0.114	0.069	5.456E-2	673	0.054	0.028	7pmk5.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
15	PDB:1ue6A	0.111	0.306	8.710E-2	110	0.028	0.091	1ue6A.pdb.gz
16	PDB:7v99A	0.085	0.038	1.237E-1	991	0.080	0.028	7v99A.pdb.gz	Zipper head mechanism of telomere synthesis by human telomerase.
17	PDB:2pi2A	0.157	0.365	1.312E-1	129	0.040	0.109	2pi2A.pdb.gz
18	PDB:3gtyX	0.109	0.097	1.474E-1	412	0.062	0.053	3gtyX.pdb.gz
19	PDB:5dfzA	0.113	0.115	1.563E-1	343	0.065	0.067	5dfzA.pdb.gz
20	PDB:6wgg2	0.068	0.047	1.863E-1	581	0.034	0.021	6wgg2.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8VCM5	0.0	640	352	0.898	0.898	MUL1_MOUSE Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Mus musculus OX=10090 GN=Mul1 PE=1 SV=2
2	Q969V5	0.0	728	352	1.000	1.000	MUL1_HUMAN Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Homo sapiens OX=9606 GN=MUL1 PE=1 SV=1
3	Q9VZJ9	3.92e-46	162	338	0.295	0.308	MUL1_DROME Mitochondrial E3 ubiquitin protein ligase 1 OS=Drosophila melanogaster OX=7227 GN=Mul1 PE=1 SV=1
4	Q8L7N4	6.31e-24	102	343	0.287	0.294	SP1_ARATH E3 ubiquitin-protein ligase SP1 OS=Arabidopsis thaliana OX=3702 GN=SP1 PE=1 SV=1
5	Q94HV7	9.14e-19	88.2	338	0.267	0.278	SPL1P_ARATH E3 ubiquitin-protein ligase SPL1 OS=Arabidopsis thaliana OX=3702 GN=SPL1 PE=2 SV=1
6	Q9SYH3	1.57e-12	70.1	383	0.165	0.151	SPL2P_ARATH E3 ubiquitin-protein ligase SPL2 OS=Arabidopsis thaliana OX=3702 GN=SPL2 PE=2 SV=1
7	F4I570	4.93e-11	64.7	277	0.213	0.271	F4I570_ARATH RING-type E3 ubiquitin transferase OS=Arabidopsis thaliana OX=3702 GN=DAL1 PE=1 SV=2
8	Q6AYH3	9.77e-09	58.5	381	0.114	0.105	RNF34_RAT E3 ubiquitin-protein ligase RNF34 OS=Rattus norvegicus OX=10116 GN=Rnf34 PE=1 SV=1
9	Q99KR6	1.21e-08	58.2	376	0.114	0.106	RNF34_MOUSE E3 ubiquitin-protein ligase RNF34 OS=Mus musculus OX=10090 GN=Rnf34 PE=1 SV=1
10	Q969K3	3.45e-08	57.0	372	0.077	0.073	RNF34_HUMAN E3 ubiquitin-protein ligase RNF34 OS=Homo sapiens OX=9606 GN=RNF34 PE=1 SV=1
11	A1Z971	4.87e-08	57.0	700	0.068	0.034	A1Z971_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=dRNF34 PE=1 SV=1
12	Q557E7	7.51e-08	56.2	665	0.077	0.041	CBLA_DICDI E3 ubiquitin-protein ligase cblA OS=Dictyostelium discoideum OX=44689 GN=cblA-1 PE=1 SV=1
13	Q8WZ73	1.86e-06	51.6	363	0.062	0.061	RFFL_HUMAN E3 ubiquitin-protein ligase rififylin OS=Homo sapiens OX=9606 GN=RFFL PE=1 SV=1
14	Q6ZQM0	2.01e-06	51.6	377	0.062	0.058	RFFL_MOUSE E3 ubiquitin-protein ligase rififylin OS=Mus musculus OX=10090 GN=Rffl PE=1 SV=1
15	F4ISV9	8.86e-06	49.7	399	0.065	0.058	APD4_ARATH E3 ubiquitin-protein ligase APD4 OS=Arabidopsis thaliana OX=3702 GN=APD4 PE=2 SV=1
16	F4IS08	1.40e-05	48.9	447	0.068	0.054	F4IS08_ARATH RING/U-box superfamily protein OS=Arabidopsis thaliana OX=3702 GN=APD1 PE=1 SV=1
17	Q0WS06	1.44e-05	48.9	441	0.068	0.054	APD1_ARATH E3 ubiquitin-protein ligase APD1 OS=Arabidopsis thaliana OX=3702 GN=APD1 PE=2 SV=1
18	Q5XIQ4	1.91e-05	48.5	533	0.085	0.056	MGRN1_RAT E3 ubiquitin-protein ligase MGRN1 OS=Rattus norvegicus OX=10116 GN=Mgrn1 PE=1 SV=1
19	B3H754	2.01e-05	48.5	404	0.062	0.054	APD3_ARATH E3 ubiquitin-protein ligase APD3 OS=Arabidopsis thaliana OX=3702 GN=APD3 PE=2 SV=1
20	Q9D074	2.18e-05	48.5	532	0.085	0.056	MGRN1_MOUSE E3 ubiquitin-protein ligase MGRN1 OS=Mus musculus OX=10090 GN=Mgrn1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11239 DUF3040	6.4e+02	12.0	Protein of unknown function (DUF3040)
2	PF19904 DUF6377	15	16.6	Domain of unknown function (DUF6377)
3	PF12483 GIDE	6.5e-19	79.4	E3 Ubiquitin ligase
4	PF06305 LapA_dom	4.8e+02	12.0	Lipopolysaccharide assembly protein A domain
5	PF08496 Peptidase_S49_N	2.5e+02	13.2	Peptidase family S49 N-terminal
6	PF14447 Prok-RING_4	0.65	21.2	Prokaryotic RING finger family 4
7	PF13923 zf-C3HC4_2	99	14.2	Zinc finger, C3HC4 type (RING finger)
8	PF13920 zf-C3HC4_3	1.3e-08	45.8	Zinc finger, C3HC4 type (RING finger)
9	PF13639 zf-RING_2	5.4	18.8	Ring finger domain
10	PF14634 zf-RING_5	7.3	18.0	zinc-RING finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000017114

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000003550	0.846	Ubiquitin-conjugating enzyme E2D 1
2	60711.ENSCSAP00000015190	0.822	Ubiquitin specific peptidase 30
3	60711.ENSCSAP00000007551	0.798	Acts as a tumor suppressor in many tumor types
4	60711.ENSCSAP00000009725	0.738	Nuclear receptor subfamily 6, group A, member 1
5	60711.ENSCSAP00000002719	0.726	Mitochondrial GTPase involved in mitochondrial trafficking.
6	60711.ENSCSAP00000012800	0.719	Ubiquitin-conjugating enzyme E2D 2
7	60711.ENSCSAP00000001654	0.704	Peptidylprolyl isomerase
8	60711.ENSCSAP00000005358	0.668	Voltage-dependent anion channel 2
9	60711.ENSCSAP00000011131	0.665	Voltage-dependent anion channel 3
10	60711.ENSCSAP00000002360	0.662	Translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)
11	60711.ENSCSAP00000006322	0.659	annotation not available
12	60711.ENSCSAP00000017634	0.659	Uncharacterized protein
13	60711.ENSCSAP00000011554	0.658	Ubiquitin-conjugating enzyme E2D 4 (putative)
14	60711.ENSCSAP00000002854	0.655	Insulin-degrading enzyme
15	60711.ENSCSAP00000002861	0.655	Membrane-associated ring finger (C3HC4) 5
16	60711.ENSCSAP00000001116	0.647	annotation not available
17	60711.ENSCSAP00000017365	0.646	Family with sequence similarity 43, member B
18	60711.ENSCSAP00000009780	0.641	Tumor suppressor which functions to suppress MRTFA-induced SRF transcriptional activity
19	60711.ENSCSAP00000009182	0.639	Belongs to the ubiquitin-conjugating enzyme family.
20	60711.ENSCSAP00000005024	0.638	Ring finger protein 185

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0031625	1.000	ubiquitin protein ligase binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0002039	0.999	p53 binding
GO:0019789	0.999	SUMO transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0009987	0.992	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0071704	0.976	organic substance metabolic process
GO:0050896	0.951	response to stimulus
GO:0048522	0.945	positive regulation of cellular process
GO:0051128	0.934	regulation of cellular component organization
GO:0050793	0.931	regulation of developmental process
GO:0044238	0.922	primary metabolic process
GO:0051716	0.922	cellular response to stimulus
GO:0006807	0.888	nitrogen compound metabolic process
GO:0043170	0.884	macromolecule metabolic process
GO:0022603	0.879	regulation of anatomical structure morphogenesis
GO:0019538	0.872	protein metabolic process
GO:0031647	0.852	regulation of protein stability
GO:0032446	0.836	protein modification by small protein conjugation
GO:0016567	0.807	protein ubiquitination
GO:0040008	0.745	regulation of growth
GO:0051179	0.686	localization
GO:0051130	0.680	positive regulation of cellular component organization
GO:0019222	0.667	regulation of metabolic process
GO:0071840	0.663	cellular component organization or biogenesis
GO:0016043	0.637	cellular component organization
GO:0033043	0.636	regulation of organelle organization
GO:0051171	0.628	regulation of nitrogen compound metabolic process
GO:0080090	0.624	regulation of primary metabolic process
GO:0051641	0.615	cellular localization
GO:0060255	0.612	regulation of macromolecule metabolic process
GO:0048523	0.612	negative regulation of cellular process
GO:0009893	0.612	positive regulation of metabolic process
GO:0048583	0.602	regulation of response to stimulus
GO:0051234	0.601	establishment of localization
GO:0051246	0.590	regulation of protein metabolic process
GO:0010821	0.586	regulation of mitochondrion organization
GO:0006996	0.583	organelle organization
GO:0051094	0.582	positive regulation of developmental process
GO:0006810	0.576	transport
GO:0000209	0.554	protein polyubiquitination
GO:0007005	0.549	mitochondrion organization
GO:0009966	0.542	regulation of signal transduction
GO:0051247	0.539	positive regulation of protein metabolic process
GO:0010638	0.476	positive regulation of organelle organization
GO:0010468	0.458	regulation of gene expression
GO:0042221	0.452	response to chemical
GO:0051649	0.451	establishment of localization in cell
GO:0010822	0.449	positive regulation of mitochondrion organization
GO:0044237	0.429	cellular metabolic process
GO:0046907	0.425	intracellular transport
GO:0051049	0.414	regulation of transport
GO:0065009	0.410	regulation of molecular function
GO:0031399	0.381	regulation of protein modification process
GO:0048584	0.378	positive regulation of response to stimulus
GO:0030162	0.364	regulation of proteolysis
GO:0090140	0.359	regulation of mitochondrial fission
GO:1902531	0.356	regulation of intracellular signal transduction
GO:0031323	0.354	regulation of cellular metabolic process
GO:0048585	0.345	negative regulation of response to stimulus
GO:0006950	0.325	response to stress
GO:0009967	0.322	positive regulation of signal transduction
GO:0080134	0.314	regulation of response to stress
GO:0009968	0.304	negative regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.973	membrane
GO:0031090	0.881	organelle membrane
GO:0031966	0.745	mitochondrial membrane
GO:0031968	0.721	organelle outer membrane
GO:0005741	0.695	mitochondrial outer membrane
GO:0005829	0.687	cytosol
GO:0005777	0.637	peroxisome
GO:0005634	0.586	nucleus
GO:0120025	0.440	plasma membrane bounded cell projection
GO:0043005	0.409	neuron projection
GO:0030424	0.400	axon

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]