StarFunc result for job id Q969W9

User Input

>input (287 residues)
MHRLMGVNSTAAAAAGQPNVSCTCNCKRSLFQSMEITELEFVQIIIIVVVMMVMVVVITC
LLSHYKLSARSFISRHSQGRRREDALSSEGCLWPSESTVSGNGIPEPQVYAPPRPTDRLA
VPPFAQRERFHRFQPTYPYLQHEIDLPPTISLSDGEEPPPYQGPCTLQLRDPEQQLELNR
ESVRAPPNRTIFDSDLMDSARLGGPCPPSSNSGISATCYGSGGRMEGPPPTYSEVIGHYP
GSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969W9	1.000	1.000	5.404E-43	287	1.000	1.000	Q969W9.pdb.gz	PMEPA_HUMAN Protein TMEPAI OS=Homo sapiens OX=9606 GN=PMEPA1 PE=1 SV=1
2	AFDB:Q9D7R2	0.407	0.437	1.324E-31	260	0.805	0.888	Q9D7R2.pdb.gz	PMEPA_MOUSE Protein TMEPAI OS=Mus musculus OX=10090 GN=Pmepa1 PE=1 SV=1
3	AFDB:O15165	0.183	0.169	4.243E-22	306	0.596	0.559	O15165.pdb.gz	LRAD4_HUMAN Low-density lipoprotein receptor class A domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LDLRAD4 PE=1 SV=1
4	AFDB:A0A1L8I316	0.098	0.089	8.411E-2	341	0.143	0.120	A0A1L8I316.pdb.gz	HWA_XENLA Protein huluwa OS=Xenopus laevis OX=8355 GN=hwa PE=2 SV=1
5	AFDB:O04532	0.102	0.059	1.921E-1	760	0.146	0.055	O04532.pdb.gz	FH8_ARATH Formin-like protein 8 OS=Arabidopsis thaliana OX=3702 GN=FH8 PE=1 SV=1
6	AFDB:Q3V2A7	0.103	0.052	2.205E-1	592	0.146	0.071	Q3V2A7.pdb.gz	QRIC2_MOUSE Glutamine-rich protein 2 OS=Mus musculus OX=10090 GN=Qrich2 PE=2 SV=1
7	AFDB:O45487	0.163	0.059	3.569E-1	891	0.125	0.040	O45487.pdb.gz	EMAL_CAEEL Echinoderm microtubule-associated protein-like elp-1 OS=Caenorhabditis elegans OX=6239 GN=elp-1 PE=3 SV=1
8	AFDB:A2RVG6	0.167	0.053	3.824E-1	1040	0.146	0.040	A2RVG6.pdb.gz	A2RVG6_DROME IP17501p OS=Drosophila melanogaster OX=7227 GN=ome PE=1 SV=1
9	AFDB:A4JYL8	0.123	0.077	5.036E-1	475	0.132	0.080	A4JYL8.pdb.gz
10	AFDB:Q7SXL7	0.153	0.109	5.036E-1	423	0.125	0.085	Q7SXL7.pdb.gz	FL2D_DANRE Pre-mRNA-splicing regulator WTAP OS=Danio rerio OX=7955 GN=wtap PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q969W9	0.0	590	287	1.000	1.000	PMEPA_HUMAN Protein TMEPAI OS=Homo sapiens OX=9606 GN=PMEPA1 PE=1 SV=1
2	Q9D7R2	9.10e-154	431	260	0.805	0.888	PMEPA_MOUSE Protein TMEPAI OS=Mus musculus OX=10090 GN=Pmepa1 PE=1 SV=1
3	A2A2F5	1.14e-109	318	227	0.585	0.740	A2A2F5_HUMAN Prostate transmembrane protein, androgen induced 1 (Fragment) OS=Homo sapiens OX=9606 GN=PMEPA1 PE=3 SV=1
4	O15165	3.34e-99	295	306	0.585	0.549	LRAD4_HUMAN Low-density lipoprotein receptor class A domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LDLRAD4 PE=1 SV=1
5	Q8BWJ4	2.39e-96	287	306	0.533	0.500	LRAD4_MOUSE Low-density lipoprotein receptor class A domain-containing protein 4 OS=Mus musculus OX=10090 GN=Ldlrad4 PE=2 SV=1
6	Q38EE3	4.7	31.2	658	0.084	0.036	Q38EE3_TRYB2 Pescadillo homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0180 PE=3 SV=1
7	Q9QYY0	6.2	30.8	695	0.073	0.030	GAB1_MOUSE GRB2-associated-binding protein 1 OS=Mus musculus OX=10090 GN=Gab1 PE=1 SV=2
8	Q12680	7.1	30.8	2145	0.077	0.010	GLT1_YEAST Glutamate synthase [NADH] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLT1 PE=1 SV=2
9	Q96CC6	9.4	30.4	855	0.059	0.020	RHDF1_HUMAN Inactive rhomboid protein 1 OS=Homo sapiens OX=9606 GN=RHBDF1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07219 HemY_N	4.5e+02	12.4	HemY protein N-terminus
2	PF15102 TMEM154	4.3e+02	12.1	TMEM154 protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345826

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000424827	0.993	E3 ubiquitin-protein ligase NEDD4
2	9606.ENSP00000262160	0.876	Mothers against decapentaplegic homolog 2
3	9606.ENSP00000332973	0.758	Mothers against decapentaplegic homolog 3
4	9606.ENSP00000363822	0.664	Androgen receptor
5	9606.ENSP00000305839	0.652	G protein-regulated inducer of neurite outgrowth 1
6	9606.ENSP00000298198	0.644	Glucose 1,6-bisphosphate synthase
7	9606.ENSP00000314151	0.642	Prostate-specific antigen
8	9606.ENSP00000216294	0.599	snRNA-activating protein complex subunit 1
9	9606.ENSP00000313581	0.583	Kallikrein-2
10	9606.ENSP00000221114	0.579	Dynactin subunit 6
11	9606.ENSP00000323635	0.552	Protein FAM210A
12	9606.ENSP00000381588	0.522	Transmembrane protease serine 2
13	9606.ENSP00000370253	0.508	Homeobox protein Nkx-3.1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070412	1.000	R-SMAD binding
GO:0050699	0.996	WW domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0019222	0.987	regulation of metabolic process
GO:0001932	0.981	regulation of protein phosphorylation
GO:0031324	0.979	negative regulation of cellular metabolic process
GO:0031400	0.975	negative regulation of protein modification process
GO:0001933	0.972	negative regulation of protein phosphorylation
GO:0060393	0.960	regulation of pathway-restricted SMAD protein phosphorylation
GO:0009966	0.869	regulation of signal transduction
GO:0017015	0.705	regulation of transforming growth factor beta receptor signaling pathway
GO:0030512	0.635	negative regulation of transforming growth factor beta receptor signaling pathway
GO:0051128	0.468	regulation of cellular component organization
GO:0048518	0.323	positive regulation of biological process
GO:0009987	0.313	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0031090	0.996	organelle membrane
GO:0031410	0.995	cytoplasmic vesicle
GO:0005886	0.982	plasma membrane
GO:0005768	0.979	endosome
GO:0010008	0.965	endosome membrane
GO:0031901	0.948	early endosome membrane
GO:0005794	0.756	Golgi apparatus
GO:0005634	0.563	nucleus
GO:0000139	0.327	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]