StarFunc result for job id Q969X0

User Input

>input (211 residues)
MEEPPVREEEEEEGEEDEERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPR
VTQLQFKVVRVLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNK
MVVDLTDPNRPRFTLQELRDVLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKD
AVVTSAKNAGRNKEEKTIIKKLFFFRSGKQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969X0	1.000	1.000	1.922E-33	211	1.000	1.000	Q969X0.pdb.gz	RIPL2_HUMAN RILP-like protein 2 OS=Homo sapiens OX=9606 GN=RILPL2 PE=1 SV=1
2	AFDB:Q99LE1	0.579	0.614	2.049E-23	197	0.735	0.787	Q99LE1.pdb.gz	RIPL2_MOUSE RILP-like protein 2 OS=Mus musculus OX=10090 GN=Rilpl2 PE=1 SV=1
3	AFDB:A0A1B0GVV3	0.299	0.170	5.041E-4	386	0.370	0.202	A0A1B0GVV3.pdb.gz	A0A1B0GVV3_HUMAN Rab interacting lysosomal protein like 1 OS=Homo sapiens OX=9606 GN=RILPL1 PE=1 SV=1
4	AFDB:Q9C117	0.260	0.260	2.732E-2	211	0.118	0.118	Q9C117.pdb.gz	YDRC_SCHPO Uncharacterized protein C16E8.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC16E8.12c PE=4 SV=2
5	AFDB:Q8CD76	0.187	0.084	1.262E-1	616	0.199	0.068	Q8CD76.pdb.gz	Q8CD76_MOUSE Kinesin light chain OS=Mus musculus OX=10090 GN=Klc1 PE=1 SV=1
6	AFDB:Q8T0Q4	0.136	0.127	1.760E-1	226	0.156	0.146	Q8T0Q4.pdb.gz	Q8T0Q4_DROME GH13992p OS=Drosophila melanogaster OX=7227 GN=shrb PE=1 SV=1
7	AFDB:Q91W40	0.195	0.098	1.882E-1	508	0.161	0.067	Q91W40.pdb.gz	KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus OX=10090 GN=Klc3 PE=1 SV=1
8	AFDB:P35845	0.215	0.051	2.149E-1	1188	0.142	0.025	P35845.pdb.gz	OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWH1 PE=1 SV=4
9	AFDB:O16242	0.132	0.055	2.624E-1	651	0.100	0.032	O16242.pdb.gz	NCX9_CAEEL Mitochondrial sodium/calcium exchanger protein OS=Caenorhabditis elegans OX=6239 GN=ncx-9 PE=1 SV=1
10	AFDB:Q3SXY8	0.189	0.116	2.624E-1	428	0.133	0.065	Q3SXY8.pdb.gz	AR13B_HUMAN ADP-ribosylation factor-like protein 13B OS=Homo sapiens OX=9606 GN=ARL13B PE=1 SV=1
11	PDB:7dkhI	0.261	0.075	9.376E-1	914	0.090	0.021	7dkhI.pdb.gz
12	PDB:5n9jG	0.225	0.274	1.002	163	0.114	0.147	5n9jG.pdb.gz
13	PDB:4n78F	0.213	0.270	1.494	156	0.104	0.141	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
14	PDB:3besR	0.207	0.177	1.949	250	0.024	0.020	3besR.pdb.gz
15	PDB:5oqrA	0.171	0.056	2.083	751	0.052	0.015	5oqrA.pdb.gz
16	PDB:7r5jV0	0.172	0.139	3.106	273	0.085	0.066	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
17	PDB:4ytpD	0.214	0.411	3.792	102	0.043	0.088	4ytpD.pdb.gz	Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
18	PDB:5ee3B	0.156	0.098	4.053	364	0.052	0.030	5ee3B.pdb.gz	ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
19	PDB:5c0wL	0.195	0.308	6.902	113	0.062	0.115	5c0wL.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
20	PDB:5n9jZ	0.164	0.272	7.884	119	0.047	0.084	5n9jZ.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q969X0	3.43e-150	417	211	1.000	1.000	RIPL2_HUMAN RILP-like protein 2 OS=Homo sapiens OX=9606 GN=RILPL2 PE=1 SV=1
2	Q99LE1	7.95e-97	281	197	0.668	0.716	RIPL2_MOUSE RILP-like protein 2 OS=Mus musculus OX=10090 GN=Rilpl2 PE=1 SV=1
3	Q5EBL4	1.94e-14	73.2	403	0.289	0.151	RIPL1_HUMAN RILP-like protein 1 OS=Homo sapiens OX=9606 GN=RILPL1 PE=1 SV=1
4	A0A1B0GVV3	5.62e-14	71.6	386	0.289	0.158	A0A1B0GVV3_HUMAN Rab interacting lysosomal protein like 1 OS=Homo sapiens OX=9606 GN=RILPL1 PE=1 SV=1
5	Q9JJC6	7.57e-14	71.6	406	0.294	0.153	RIPL1_MOUSE RILP-like protein 1 OS=Mus musculus OX=10090 GN=Rilpl1 PE=1 SV=1
6	D3ZUQ0	1.29e-13	70.9	406	0.284	0.148	RIPL1_RAT RILP-like protein 1 OS=Rattus norvegicus OX=10116 GN=Rilpl1 PE=1 SV=1
7	O76878	0.004	39.7	443	0.090	0.043	RIPL_DROME RILP-like protein homolog OS=Drosophila melanogaster OX=7227 GN=Rilpl PE=1 SV=1
8	Q5ND29	0.084	35.8	369	0.076	0.043	RILP_MOUSE Rab-interacting lysosomal protein OS=Mus musculus OX=10090 GN=Rilp PE=1 SV=1
9	L7RKJ8	0.15	35.4	1299	0.142	0.023	L7RKJ8_DANRE C-Jun-amino-terminal kinase-interacting protein 3 OS=Danio rerio OX=7955 GN=mapk8ip3 PE=2 SV=1
10	Q96NA2	0.17	35.0	401	0.076	0.040	RILP_HUMAN Rab-interacting lysosomal protein OS=Homo sapiens OX=9606 GN=RILP PE=1 SV=1
11	A0A8I6AXC7	0.31	34.3	1305	0.171	0.028	A0A8I6AXC7_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
12	P15924	1.2	32.7	2871	0.161	0.012	DESP_HUMAN Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3
13	Q9UUY2	2.0	32.0	1385	0.100	0.015	Q9UUY2_NEUCS P-type Ca(2+) transporter (Fragment) OS=Neurospora crassa OX=5141 GN=nca-2 PE=4 SV=1
14	A0A8I5Y1R0	3.8	30.8	1305	0.090	0.015	A0A8I5Y1R0_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
15	Q58A65	3.8	30.8	1321	0.090	0.014	JIP4_MOUSE C-Jun-amino-terminal kinase-interacting protein 4 OS=Mus musculus OX=10090 GN=Spag9 PE=1 SV=2
16	A0A0G2K6E8	3.9	30.8	1352	0.090	0.014	A0A0G2K6E8_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
17	E9PSJ4	3.9	30.8	1324	0.090	0.014	E9PSJ4_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=3
18	A0A1D8PE84	4.0	30.8	1490	0.095	0.013	A0A1D8PE84_CANAL Cdr4p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDR4 PE=4 SV=1
19	A0A8I5ZJK4	4.0	30.8	1334	0.090	0.014	A0A8I5ZJK4_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
20	A0A8I6B3N0	4.0	30.8	1321	0.090	0.014	A0A8I6B3N0_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09744 Jnk-SapK_ap_N	15	17.3	JNK_SAPK-associated protein-1
2	PF11461 RILP	7.1e-26	101.9	Rab interacting lysosomal protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280571

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382177	0.858	Unconventional myosin-Va
2	9606.ENSP00000264605	0.846	Melanophilin
3	9606.ENSP00000300935	0.835	Ras-related protein Rab-8A
4	9606.ENSP00000264710	0.738	Ras-related protein Rab-10
5	9606.ENSP00000289359	0.736	MIT domain-containing protein 1
6	9606.ENSP00000300179	0.636	Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 1
7	9606.ENSP00000426455	0.616	Ribonuclease T2
8	9606.ENSP00000396467	0.593	MAP kinase-activated protein kinase 3
9	9606.ENSP00000356107	0.563	Ras-related protein Rab-7L1
10	9606.ENSP00000261839	0.549	Unconventional myosin-Vc
11	9606.ENSP00000193322	0.534	Osteopetrosis-associated transmembrane protein 1
12	9606.ENSP00000476145	0.509	Tyrosine-protein kinase FRK

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0090150	0.985	establishment of protein localization to membrane
GO:0000902	0.984	cell morphogenesis
GO:0072659	0.983	protein localization to plasma membrane
GO:0006886	0.978	intracellular protein transport
GO:0002064	0.977	epithelial cell development
GO:0071840	0.976	cellular component organization or biogenesis
GO:0016043	0.973	cellular component organization
GO:0000904	0.970	cell morphogenesis involved in differentiation
GO:0003382	0.869	epithelial cell morphogenesis
GO:0061951	0.824	establishment of protein localization to plasma membrane
GO:0061024	0.743	membrane organization
GO:0065007	0.552	biological regulation
GO:0050789	0.425	regulation of biological process
GO:0050794	0.404	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0043229	0.973	intracellular organelle
GO:0043227	0.968	membrane-bounded organelle
GO:0043231	0.824	intracellular membrane-bounded organelle
GO:0016020	0.789	membrane
GO:0120025	0.676	plasma membrane bounded cell projection
GO:0012505	0.505	endomembrane system
GO:0043232	0.492	intracellular non-membrane-bounded organelle
GO:0005856	0.322	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]