StarFunc result for job id Q969X2

User Input

>input (333 residues)
MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYS
SNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGT
KLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVF
IFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHS
WLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEH
SRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969X2	1.000	1.000	2.126E-70	333	1.000	1.000	Q969X2.pdb.gz	SIA7F_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 OS=Homo sapiens OX=9606 GN=ST6GALNAC6 PE=1 SV=1
2	AFDB:Q9BVH7	0.727	0.720	1.759E-34	336	0.411	0.408	Q9BVH7.pdb.gz	SIA7E_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 OS=Homo sapiens OX=9606 GN=ST6GALNAC5 PE=1 SV=1
3	AFDB:Q8NDV1	0.706	0.769	2.553E-30	305	0.345	0.377	Q8NDV1.pdb.gz	SIA7C_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 OS=Homo sapiens OX=9606 GN=ST6GALNAC3 PE=1 SV=1
4	AFDB:Q64686	0.708	0.771	1.326E-29	305	0.330	0.361	Q64686.pdb.gz	SIA7C_RAT Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 OS=Rattus norvegicus OX=10116 GN=St6galnac3 PE=1 SV=1
5	AFDB:Q9H4F1	0.706	0.777	2.198E-28	302	0.342	0.377	Q9H4F1.pdb.gz	SIA7D_HUMAN Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase OS=Homo sapiens OX=9606 GN=ST6GALNAC4 PE=2 SV=2
6	AFDB:Q6KC03	0.486	0.457	5.533E-13	358	0.195	0.182	Q6KC03.pdb.gz	Q6KC03_DANRE Alpha-2,8-sialyltransferase ST8Sia IV OS=Danio rerio OX=7955 GN=pst PE=2 SV=1
7	AFDB:A1KQY6	0.499	0.382	9.016E-13	454	0.207	0.152	A1KQY6.pdb.gz	A1KQY6_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St8sia4 PE=3 SV=1
8	AFDB:B0CN48	0.545	0.490	2.875E-12	374	0.171	0.152	B0CN48.pdb.gz	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
9	AFDB:P61131	0.494	0.494	4.685E-12	333	0.153	0.153	P61131.pdb.gz	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
10	AFDB:Q94DD4	0.429	0.370	4.685E-12	393	0.138	0.117	Q94DD4.pdb.gz	STLP1_ORYSJ Sialyltransferase-like protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=STLP1 PE=2 SV=1
11	PDB:6aplC	0.436	0.470	3.666E-9	306	0.126	0.137	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
12	PDB:1vyhA	0.168	0.226	1.374E-2	218	0.054	0.083	1vyhA.pdb.gz
13	PDB:3dt9A	0.186	0.262	1.461E-2	212	0.057	0.090	3dt9A.pdb.gz	Crystal structures of brain group-VIII phospholipase A2 in nonaged complexes with the organophosphorus nerve agents soman and sarin.
14	PDB:6f2cA	0.158	0.331	2.107E-2	124	0.048	0.129	6f2cA.pdb.gz
15	PDB:3lvqE	0.160	0.132	2.380E-2	420	0.048	0.038	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
16	PDB:7o6pD	0.167	0.194	4.382E-2	257	0.114	0.148	7o6pD.pdb.gz
17	PDB:1oy0B	0.170	0.205	4.951E-2	248	0.057	0.077	1oy0B.pdb.gz	The Crystal Structure of the First Enzyme in the Pantothenate Biosynthetic Pathway, Ketopantoate Hydroxymethyltransferase, from M. tuberculosis
18	PDB:6emmA	0.189	0.220	4.951E-2	268	0.072	0.090	6emmA.pdb.gz	X-ray Crystallographic Fragment screening and Hit Optimization
19	PDB:2gdzA	0.219	0.255	5.263E-2	266	0.054	0.068	2gdzA.pdb.gz	High-Affinity Inhibitors of Human NAD-Dependent 15-Hydroxyprostaglandin Dehydrogenase: Mechanisms of Inhibition and Structure-Activity Relationships.
20	PDB:3oa2B	0.194	0.205	5.263E-2	311	0.027	0.029	3oa2B.pdb.gz	Structural and Functional Studies of WlbA: A Dehydrogenase Involved in the Biosynthesis of 2,3-Diacetamido-2,3-dideoxy-d-mannuronic Acid .

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q969X2	0.0	694	333	1.000	1.000	SIA7F_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 OS=Homo sapiens OX=9606 GN=ST6GALNAC6 PE=1 SV=1
2	Q9JM95	0.0	657	333	0.931	0.931	SIA7F_MOUSE Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 OS=Mus musculus OX=10090 GN=St6galnac6 PE=1 SV=1
3	Q9QYJ1	2.46e-94	285	336	0.387	0.384	SIA7E_MOUSE Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 OS=Mus musculus OX=10090 GN=St6galnac5 PE=1 SV=1
4	Q9BVH7	1.23e-92	281	336	0.381	0.378	SIA7E_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 OS=Homo sapiens OX=9606 GN=ST6GALNAC5 PE=1 SV=1
5	Q64686	4.82e-70	222	305	0.312	0.341	SIA7C_RAT Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 OS=Rattus norvegicus OX=10116 GN=St6galnac3 PE=1 SV=1
6	Q8NDV1	2.21e-69	220	305	0.318	0.348	SIA7C_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 OS=Homo sapiens OX=9606 GN=ST6GALNAC3 PE=1 SV=1
7	Q9H4F1	3.08e-64	207	302	0.300	0.331	SIA7D_HUMAN Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase OS=Homo sapiens OX=9606 GN=ST6GALNAC4 PE=2 SV=2
8	A0A087WWK2	1.94e-31	117	139	0.165	0.396	A0A087WWK2_HUMAN ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 (Fragment) OS=Homo sapiens OX=9606 GN=ST6GALNAC3 PE=1 SV=1
9	Q64685	2.58e-15	78.6	403	0.165	0.136	SIAT1_MOUSE Beta-galactoside alpha-2,6-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St6gal1 PE=1 SV=2
10	P13721	1.84e-13	72.8	403	0.159	0.132	SIAT1_RAT Beta-galactoside alpha-2,6-sialyltransferase 1 OS=Rattus norvegicus OX=10116 GN=St6gal1 PE=1 SV=2
11	Q76K27	2.66e-13	72.8	524	0.150	0.095	SIAT2_MOUSE Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St6gal2 PE=2 SV=2
12	P15907	3.30e-13	72.0	406	0.168	0.138	SIAT1_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST6GAL1 PE=1 SV=1
13	Q96JF0	4.46e-13	72.0	529	0.144	0.091	SIAT2_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GAL2 PE=1 SV=2
14	Q11201	2.18e-12	69.3	340	0.180	0.176	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
15	P54751	3.95e-12	68.6	337	0.174	0.172	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
16	B0CN48	4.22e-12	68.6	374	0.153	0.136	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
17	Q11206	1.92e-11	66.2	333	0.177	0.177	SIA4C_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Homo sapiens OX=9606 GN=ST3GAL4 PE=1 SV=1
18	Q02745	2.91e-11	65.9	343	0.171	0.166	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
19	Q64689	9.96e-11	64.7	380	0.147	0.129	SIA8C_MOUSE Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia3 PE=1 SV=2
20	Q91Y74	3.36e-10	62.8	333	0.153	0.153	SIA4C_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Mus musculus OX=10090 GN=St3gal4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15548 DUF4655	2.4e+02	11.8	Domain of unknown function (DUF4655)
2	PF00777 Glyco_transf_29	2.3e-29	114.4	Glycosyltransferase family 29 (sialyltransferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000021253

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007097	0.923	ST3 beta-galactoside alpha-2,3-sialyltransferase 1
2	61853.ENSNLEP00000021254	0.823	Belongs to the glycosyltransferase 29 family.
3	61853.ENSNLEP00000011723	0.809	ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
4	61853.ENSNLEP00000022873	0.707	Hexosyltransferase
5	61853.ENSNLEP00000017196	0.677	Podocalyxin-like 2
6	61853.ENSNLEP00000015964	0.671	Hexosyltransferase
7	61853.ENSNLEP00000003049	0.639	ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
8	61853.ENSNLEP00000013790	0.633	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5
9	61853.ENSNLEP00000021931	0.581	Hexosyltransferase
10	61853.ENSNLEP00000019501	0.579	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
11	61853.ENSNLEP00000019524	0.558	ST3 beta-galactoside alpha-2,3-sialyltransferase 2
12	61853.ENSNLEP00000008101	0.544	Polypeptide N-acetylgalactosaminyltransferase 7
13	61853.ENSNLEP00000001324	0.535	Polypeptide N-acetylgalactosaminyltransferase 15
14	61853.ENSNLEP00000024224	0.522	Polypeptide N-acetylgalactosaminyltransferase 6
15	61853.ENSNLEP00000004122	0.521	G kinase anchoring protein 1
16	61853.ENSNLEP00000003876	0.520	Cysteine-serine-rich nuclear protein 3
17	61853.ENSNLEP00000003921	0.505	Polypeptide N-acetylgalactosaminyltransferase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0005488	0.959	binding
GO:0005515	0.918	protein binding
GO:0001665	0.886	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0009987	0.995	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.994	cellular metabolic process
GO:1901135	0.993	carbohydrate derivative metabolic process
GO:1901564	0.991	organonitrogen compound metabolic process
GO:1901576	0.986	organic substance biosynthetic process
GO:1901137	0.979	carbohydrate derivative biosynthetic process
GO:0044249	0.956	cellular biosynthetic process
GO:1901566	0.956	organonitrogen compound biosynthetic process
GO:0006672	0.955	ceramide metabolic process
GO:0006687	0.949	glycosphingolipid metabolic process
GO:0030148	0.903	sphingolipid biosynthetic process
GO:0009100	0.900	glycoprotein metabolic process
GO:0016051	0.898	carbohydrate biosynthetic process
GO:0009311	0.890	oligosaccharide metabolic process
GO:0008037	0.873	cell recognition
GO:0009988	0.717	cell-cell recognition
GO:0009312	0.588	oligosaccharide biosynthetic process
GO:0006486	0.578	protein glycosylation
GO:0009247	0.484	glycolipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005794	0.999	Golgi apparatus
GO:0000139	0.991	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.
RHEA:11136	0.886	a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = a beta-D-galactosyl-(1->3)-[N-acetyl-alpha-neuraminyl-(2->6)]-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+)
EC:2.4.99.3	0.886	Transferred entry: 2.4.3.3.

[back to server]