StarFunc result for job id Q969Y2

User Input

>input (492 residues)
MWRGLWTLAAQAARGPRRLCTRRSSGAPAPGSGATIFALSSGQGRCGIAVIRTSGPASGH
ALRILTAPRDLPLARHASLRLLSDPRSGEPLDRALVLWFPGPQSFTGEDCVEFHVHGGPA
VVSGVLQALGSVPGLRPAEAGEFTRRAFANGKLNLTEVEGLADLIHAETEAQRRQALRQL
DGELGHLCRGWAETLTKALAHVEAYIDFGEDDNLEEGVLEQADIEVRALQVALGAHLRDA
RRGQRLRSGVHVVVTGPPNAGKSSLVNLLSRKPVSIVSPEPGTTRDVLETPVDLAGFPVL
LSDTAGLREGVGPVEQEGVRRARERLEQADLILAMLDASDLASPSSCNFLATVVASVGAQ
SPSDSSQRLLLVLNKSDLLSPEGPGPGPDLPPHLLLSCLTGEGLDGLLEALRKELAAVCG
DPSTDPPLLTRARHQHHLQGCLDALGHYKQSKDLALAAEALRVARGHLTRLTGGGGTEEI
LDIIFQDFCVGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969Y2	1.000	1.000	6.087E-95	492	1.000	1.000	Q969Y2.pdb.gz	GTPB3_HUMAN tRNA modification GTPase GTPBP3, mitochondrial OS=Homo sapiens OX=9606 GN=GTPBP3 PE=1 SV=2
2	AFDB:Q923K4	0.911	0.911	1.201E-75	492	0.811	0.811	Q923K4.pdb.gz	GTPB3_MOUSE tRNA modification GTPase GTPBP3, mitochondrial OS=Mus musculus OX=10090 GN=Gtpbp3 PE=2 SV=1
3	AFDB:Q501Z5	0.852	0.839	7.671E-59	500	0.561	0.552	Q501Z5.pdb.gz	GTPB3_DANRE tRNA modification GTPase GTPBP3, mitochondrial OS=Danio rerio OX=7955 GN=gtpbp3 PE=2 SV=1
4	AFDB:Q9UTE7	0.831	0.825	3.628E-44	496	0.343	0.341	Q9UTE7.pdb.gz	MSS1_SCHPO tRNA modification GTPase mss1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mss1 PE=3 SV=1
5	AFDB:P32559	0.807	0.758	7.522E-43	526	0.358	0.335	P32559.pdb.gz	MSS1_YEAST tRNA modification GTPase MSS1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSS1 PE=1 SV=2
6	AFDB:P25522	0.721	0.774	2.741E-40	454	0.343	0.372	P25522.pdb.gz	MNME_ECOLI tRNA modification GTPase MnmE OS=Escherichia coli (strain K12) OX=83333 GN=mnmE PE=1 SV=3
7	AFDB:Q8YN91	0.712	0.758	5.584E-36	459	0.305	0.327	Q8YN91.pdb.gz	MNME_NOSS1 tRNA modification GTPase MnmE OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=mnmE PE=1 SV=1
8	AFDB:Q8KAS1	0.767	0.795	5.975E-35	473	0.305	0.317	Q8KAS1.pdb.gz	MNME_CHLTE tRNA modification GTPase MnmE OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=mnmE PE=1 SV=1
9	PDB:3gehA	0.707	0.778	2.163E-32	442	0.278	0.310	3gehA.pdb.gz	Kissing G domains of MnmE monitored by X-ray crystallography and pulse electron paramagnetic resonance spectroscopy
10	AFDB:P75104	0.710	0.780	4.042E-31	442	0.240	0.267	P75104.pdb.gz	MNME_MYCPN tRNA modification GTPase MnmE OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=mnmE PE=1 SV=1
11	PDB:3geiA	0.681	0.771	1.427E-30	428	0.268	0.308	3geiA.pdb.gz
12	PDB:3geiC	0.532	0.865	6.582E-18	298	0.185	0.305	3geiC.pdb.gz
13	AFDB:O33230	0.259	0.258	2.749E-9	495	0.148	0.147	O33230.pdb.gz	O33230_MYCTU GTPase HflX OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hflX PE=1 SV=1
14	PDB:7of4C	0.269	0.309	3.089E-8	422	0.136	0.159	7of4C.pdb.gz	Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
15	PDB:5ady6	0.258	0.292	1.905E-7	426	0.136	0.157	5ady6.pdb.gz	Hflx is a Ribosome Splitting Factor Rescuing Stalled Ribosomes Under Stress Conditions
16	PDB:3j8gX	0.258	0.297	5.808E-6	418	0.108	0.127	3j8gX.pdb.gz	Structural insights into the function of a unique tandem GTPase EngA in bacterial ribosome assembly
17	PDB:4zi2A	0.224	0.540	2.304E-5	185	0.071	0.189	4zi2A.pdb.gz	The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
18	PDB:2wkpA	0.238	0.347	2.719E-5	320	0.093	0.144	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
19	PDB:6hxuA	0.245	0.588	3.208E-5	182	0.087	0.236	6hxuA.pdb.gz	A Targeted Protein Degradation Cell-Based Screening for Nanobodies Selective toward the Cellular RHOB GTP-Bound Conformation.
20	PDB:6oikA	0.199	0.411	5.268E-5	217	0.091	0.207	6oikA.pdb.gz	Structures of the M1 and M2 muscarinic acetylcholine receptor/G-protein complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q923K4	0.0	723	492	0.811	0.811	GTPB3_MOUSE tRNA modification GTPase GTPBP3, mitochondrial OS=Mus musculus OX=10090 GN=Gtpbp3 PE=2 SV=1
2	Q969Y2	0.0	971	492	1.000	1.000	GTPB3_HUMAN tRNA modification GTPase GTPBP3, mitochondrial OS=Homo sapiens OX=9606 GN=GTPBP3 PE=1 SV=2
3	Q501Z5	8.81e-173	497	500	0.561	0.552	GTPB3_DANRE tRNA modification GTPase GTPBP3, mitochondrial OS=Danio rerio OX=7955 GN=gtpbp3 PE=2 SV=1
4	P32559	1.78e-91	290	526	0.362	0.338	MSS1_YEAST tRNA modification GTPase MSS1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSS1 PE=1 SV=2
5	Q9UTE7	1.25e-86	276	496	0.348	0.345	MSS1_SCHPO tRNA modification GTPase mss1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mss1 PE=3 SV=1
6	P25522	1.98e-76	249	454	0.356	0.385	MNME_ECOLI tRNA modification GTPase MnmE OS=Escherichia coli (strain K12) OX=83333 GN=mnmE PE=1 SV=3
7	Q8KAS1	4.94e-61	209	473	0.297	0.309	MNME_CHLTE tRNA modification GTPase MnmE OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=mnmE PE=1 SV=1
8	Q8YN91	1.19e-56	197	459	0.331	0.355	MNME_NOSS1 tRNA modification GTPase MnmE OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=mnmE PE=1 SV=1
9	P75104	2.24e-36	141	442	0.254	0.283	MNME_MYCPN tRNA modification GTPase MnmE OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=mnmE PE=1 SV=1
10	P0A6P5	1.98e-10	65.1	490	0.100	0.100	DER_ECOLI GTPase Der OS=Escherichia coli (strain K12) OX=83333 GN=der PE=1 SV=1
11	O33230	6.77e-08	57.4	495	0.130	0.129	O33230_MYCTU GTPase HflX OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=hflX PE=1 SV=1
12	K7UTH7	9.17e-08	56.6	416	0.087	0.103	ERA1_MAIZE GTPase ERA1, chloroplastic OS=Zea mays OX=4577 GN=ERA1 PE=2 SV=1
13	P9WNL3	1.65e-07	55.8	463	0.081	0.086	DER_MYCTU GTPase Der OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=der PE=1 SV=1
14	F4KFX1	1.74e-07	56.2	621	0.085	0.068	F4KFX1_ARATH GTPase Der OS=Arabidopsis thaliana OX=3702 GN=ENGA-2 PE=1 SV=1
15	Q8VZ74	1.90e-06	52.4	427	0.083	0.096	ERA_ARATH GTPase ERA-like, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g66470 PE=2 SV=1
16	P42182	1.80e-05	48.9	301	0.093	0.153	ERA_BACSU GTPase Era OS=Bacillus subtilis (strain 168) OX=224308 GN=era PE=1 SV=1
17	B5X565	2.30e-05	49.3	663	0.065	0.048	B5X565_ARATH GTPase Der OS=Arabidopsis thaliana OX=3702 GN=EMB2738 PE=1 SV=1
18	O82653	3.83e-05	48.5	437	0.098	0.110	ERG_ARATH GTP-binding protein ERG OS=Arabidopsis thaliana OX=3702 GN=ERG PE=1 SV=2
19	Q97IJ0	1.46e-04	46.6	411	0.055	0.066	Q97IJ0_CLOAB Predicted GTPase with uncharacterized domain, ortholog of T.maritima (4980952) OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=CA_C1651 PE=1 SV=1
20	P52131	3.77e-04	44.7	287	0.081	0.139	YFJP_ECOLI Uncharacterized protein YfjP OS=Escherichia coli (strain K12) OX=83333 GN=yfjP PE=4 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	29	16.5	AAA ATPase domain
2	PF13238 AAA_18	1.2e+02	14.7	AAA domain
3	PF13521 AAA_28	20	16.9	AAA domain
4	PF00350 Dynamin_N	0.005	28.4	Dynamin family
5	PF02421 FeoB_N	0.82	20.7	Ferrous iron transport protein B
6	PF00493 MCM	3.7e+02	11.6	MCM P-loop domain
7	PF01926 MMR_HSR1	3.8e-16	70.6	50S ribosome-binding GTPase
8	PF12631 MnmE_helical	5.1e-43	159.2	MnmE helical domain
9	PF11602 NTPase_P4	3.8e+02	11.7	ATPase P4 of dsRNA bacteriophage phi-12
10	PF03193 RsgA_GTPase	78	14.6	RsgA GTPase
11	PF05496 RuvB_N	4.5e+02	12.0	Holliday junction DNA helicase RuvB P-loop domain
12	PF10396 TrmE_N	5.2e-33	125.2	GTP-binding protein TrmE N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351644

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000402038	0.998	Protein MTO1 homolog, mitochondrial
2	9606.ENSP00000290846	0.993	Mitochondrial tRNA-specific 2-thiouridylase 1
3	9606.ENSP00000356134	0.853	Dimethyladenosine transferase 1, mitochondrial
4	9606.ENSP00000365837	0.747	tRNA pseudouridine synthase A
5	9606.ENSP00000354040	0.737	Nucleolar GTP-binding protein 1
6	9606.ENSP00000438993	0.726	Zinc finger CCHC domain-containing protein 8
7	9606.ENSP00000321810	0.721	tRNA dimethylallyltransferase
8	9606.ENSP00000349970	0.720	Endoplasmic reticulum-Golgi intermediate compartment protein 3
9	9606.ENSP00000353270	0.720	Endoplasmic reticulum-Golgi intermediate compartment protein 2
10	9606.ENSP00000377374	0.720	Endoplasmic reticulum-Golgi intermediate compartment protein 1
11	9606.ENSP00000408576	0.702	Probable leucine--tRNA ligase, mitochondrial
12	9606.ENSP00000291495	0.689	Cartilage intermediate layer protein 2
13	9606.ENSP00000373176	0.689	GTP binding protein 8
14	9606.ENSP00000298317	0.686	Mitochondrial RNA pseudouridine synthase RPUSD4
15	9606.ENSP00000373331	0.679	Mitochondrial mRNA pseudouridine synthase RPUSD3
16	9606.ENSP00000306548	0.669	Mitochondrial ribosomal protein L13
17	9606.ENSP00000260102	0.658	Mitochondrial ribosomal protein L15
18	9606.ENSP00000264995	0.655	Mitochondrial ribosomal protein L3
19	9606.ENSP00000354580	0.649	Mitochondrial ribosomal protein L21
20	9606.ENSP00000400646	0.649	Polyribonucleotide nucleotidyltransferase 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003824	0.705	catalytic activity
GO:1901363	0.504	heterocyclic compound binding
GO:0097159	0.503	organic cyclic compound binding
GO:0003723	0.348	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.975	organic substance metabolic process
GO:0044237	0.975	cellular metabolic process
GO:0044238	0.917	primary metabolic process
GO:0006807	0.879	nitrogen compound metabolic process
GO:0043170	0.873	macromolecule metabolic process
GO:0034641	0.797	cellular nitrogen compound metabolic process
GO:0046483	0.751	heterocycle metabolic process
GO:1901360	0.697	organic cyclic compound metabolic process
GO:0006725	0.653	cellular aromatic compound metabolic process
GO:0006139	0.644	nucleobase-containing compound metabolic process
GO:0010467	0.575	gene expression
GO:0090304	0.421	nucleic acid metabolic process
GO:1901564	0.407	organonitrogen compound metabolic process
GO:0044260	0.300	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005634	0.959	nucleus
GO:0070013	0.541	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]