StarFunc result for job id Q969Z0

User Input

>input (631 residues)
MAAHLVKRCTCLLREAARQAPAMAPVGRLRLAWVAHKTLTSSATSPISHLPGSLMEPVEK
ERASTPYIEKQVDHLIKKATRPEELLELLGGSHDLDSNQAAMVLIRLSHLLSEKPEDKGL
LIQDAHFHQLLCLLNSQIASVWHGTLSKLLGSLYALGIPKASKELQSVEQEVRWRMRKLK
YKHLAFLAESCATLSQEQHSQELLAELLTHLERRWTEIEDSHTLVTVMMKVGHLSEPLMN
RLEDKCLELVEHFGPNELRKVLVMLAAQSRRSVPLLRAISYHLVQKPFSLTKDVLLDVAY
AYGKLSFHQTQVSQRLATDLLSLMPSLTSGEVAHCAKSFALLKWLSLPLFEAFAQHVLNR
AQDITLPHLCSVLLAFARLNFHPDQEDQFFSLVHEKLGSELPGLEPALQVDLVWALCVLQ
QAREAELQAVLHPEFHIQFLGGKSQKDQNTFQKLLHINATALLEYPEYSGPLLPASAVAP
GPSALDRKVTPLQKELQETLKGLLGSADKGSLEVATQYGWVLDAEVLLDSDGEFLPVRDF
VAPHLAQPTGSQSPPPGSKRLAFLRWEFPNFNSRSKDLLGRFVLARRHIVAAGFLIVDVP
FYEWLELKSEWQKGAYLKDKMRKAVAEELAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B4DU42	0.921	0.906	4.974E-77	642	1.000	0.983	B4DU42.pdb.gz	B4DU42_HUMAN cDNA FLJ56153, highly similar to Homo sapiens transforming growth factor beta regulator 4 (TBRG4), transcript variant 1, mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q91YM4	0.861	0.863	2.257E-62	630	0.753	0.754	Q91YM4.pdb.gz	FAKD4_MOUSE FAST kinase domain-containing protein 4 OS=Mus musculus OX=10090 GN=Tbrg4 PE=1 SV=1
3	AFDB:C9IZN7	0.312	0.653	7.085E-25	283	0.447	0.996	C9IZN7.pdb.gz	C9IZN7_HUMAN Transforming growth factor beta regulator 4 (Fragment) OS=Homo sapiens OX=9606 GN=TBRG4 PE=1 SV=1
4	AFDB:Q14CZ7	0.598	0.573	1.148E-22	662	0.216	0.205	Q14CZ7.pdb.gz	FAKD3_HUMAN FAST kinase domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD3 PE=1 SV=2
5	AFDB:A0A024R3X5	0.712	0.640	8.380E-22	710	0.173	0.154	A0A024R3X5.pdb.gz
6	AFDB:Q922E6	0.695	0.642	2.558E-20	689	0.170	0.155	Q922E6.pdb.gz	FAKD2_MOUSE FAST kinase domain-containing protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Fastkd2 PE=2 SV=2
7	AFDB:Q7L8L6	0.630	0.533	5.913E-19	764	0.197	0.162	Q7L8L6.pdb.gz	FAKD5_HUMAN FAST kinase domain-containing protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD5 PE=1 SV=1
8	AFDB:Q53R41	0.439	0.333	8.851E-17	847	0.177	0.132	Q53R41.pdb.gz	FAKD1_HUMAN FAST kinase domain-containing protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD1 PE=1 SV=1
9	AFDB:Q14296	0.406	0.459	1.558E-13	549	0.193	0.222	Q14296.pdb.gz	FASTK_HUMAN Fas-activated serine/threonine kinase OS=Homo sapiens OX=9606 GN=FASTK PE=1 SV=1
10	AFDB:Q84MH1	0.440	0.434	8.297E-12	640	0.165	0.163	Q84MH1.pdb.gz	RAP_ORYSJ RAP domain-containing protein, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=AL1 PE=2 SV=1
11	PDB:7p3xB	0.212	0.214	1.255E-3	621	0.101	0.103	7p3xB.pdb.gz
12	PDB:7wttK	0.171	0.123	1.658E-3	1022	0.130	0.080	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
13	PDB:7p3xA	0.364	0.392	3.820E-3	576	0.078	0.085	7p3xA.pdb.gz
14	PDB:2xwuB	0.265	0.205	4.479E-3	910	0.100	0.069	2xwuB.pdb.gz
15	PDB:5gm6G	0.250	0.195	5.046E-3	875	0.092	0.066	5gm6G.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:7unkA	0.195	0.139	5.046E-3	1047	0.124	0.074	7unkA.pdb.gz
17	PDB:3w3zA	0.204	0.147	5.464E-3	1013	0.101	0.063	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
18	PDB:4r0zA	0.337	0.368	5.464E-3	557	0.098	0.111	4r0zA.pdb.gz
19	PDB:4m57A	0.258	0.242	5.916E-3	702	0.120	0.108	4m57A.pdb.gz
20	PDB:5svdA	0.255	0.281	5.916E-3	543	0.087	0.101	5svdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DU42	0.0	1277	642	1.000	0.983	B4DU42_HUMAN cDNA FLJ56153, highly similar to Homo sapiens transforming growth factor beta regulator 4 (TBRG4), transcript variant 1, mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
2	C9IZN7	0.0	554	283	0.448	1.000	C9IZN7_HUMAN Transforming growth factor beta regulator 4 (Fragment) OS=Homo sapiens OX=9606 GN=TBRG4 PE=1 SV=1
3	Q91YM4	0.0	940	630	0.756	0.757	FAKD4_MOUSE FAST kinase domain-containing protein 4 OS=Mus musculus OX=10090 GN=Tbrg4 PE=1 SV=1
4	Q969Z0	0.0	1275	631	1.000	1.000	FAKD4_HUMAN FAST kinase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=TBRG4 PE=1 SV=1
5	C9J7P5	2.23e-175	499	248	0.393	1.000	C9J7P5_HUMAN Transforming growth factor beta regulator 4 (Fragment) OS=Homo sapiens OX=9606 GN=TBRG4 PE=1 SV=1
6	C9J347	7.40e-84	260	128	0.203	1.000	C9J347_HUMAN Transforming growth factor beta regulator 4 (Fragment) OS=Homo sapiens OX=9606 GN=TBRG4 PE=1 SV=1
7	C9J5A2	9.42e-76	239	118	0.187	1.000	C9J5A2_HUMAN Transforming growth factor beta regulator 4 (Fragment) OS=Homo sapiens OX=9606 GN=TBRG4 PE=1 SV=1
8	C9J618	4.71e-65	210	103	0.163	1.000	C9J618_HUMAN Transforming growth factor beta regulator 4 (Fragment) OS=Homo sapiens OX=9606 GN=TBRG4 PE=1 SV=1
9	Q14CZ7	1.44e-23	107	662	0.212	0.202	FAKD3_HUMAN FAST kinase domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD3 PE=1 SV=2
10	Q9JIX9	6.11e-11	67.4	511	0.127	0.157	FASTK_MOUSE Fas-activated serine/threonine kinase OS=Mus musculus OX=10090 GN=Fastk PE=1 SV=1
11	Q53R41	1.73e-10	66.6	847	0.119	0.089	FAKD1_HUMAN FAST kinase domain-containing protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD1 PE=1 SV=1
12	Q9NYY8	4.14e-10	65.1	710	0.157	0.139	FAKD2_HUMAN FAST kinase domain-containing protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD2 PE=1 SV=1
13	Q14296	6.52e-10	64.3	549	0.122	0.140	FASTK_HUMAN Fas-activated serine/threonine kinase OS=Homo sapiens OX=9606 GN=FASTK PE=1 SV=1
14	Q922E6	1.14e-06	54.3	689	0.151	0.138	FAKD2_MOUSE FAST kinase domain-containing protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Fastkd2 PE=2 SV=2
15	Q7L8L6	0.007	42.0	764	0.116	0.096	FAKD5_HUMAN FAST kinase domain-containing protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD5 PE=1 SV=1
16	Q84MH1	3.2	33.1	640	0.024	0.023	RAP_ORYSJ RAP domain-containing protein, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=AL1 PE=2 SV=1
17	Q8VZE7	3.7	33.1	671	0.029	0.027	RAP_ARATH RAP domain-containing protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RAP PE=1 SV=1
18	Q94AX4	7.0	32.3	567	0.036	0.041	DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DLD PE=1 SV=1
19	Q9JII9	8.7	31.6	367	0.059	0.101	CXCR3_RAT C-X-C chemokine receptor type 3 OS=Rattus norvegicus OX=10116 GN=Cxcr3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06743 FAST_1	1.7e-19	80.8	FAST kinase-like protein, subdomain 1
2	PF08368 FAST_2	2.7e-20	84.1	FAST kinase-like protein, subdomain 2
3	PF02260 FATC	20	16.3	FATC domain
4	PF08373 RAP	1.2e-05	36.6	RAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258770

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400646	0.720	Polyribonucleotide nucleotidyltransferase 1, mitochondrial
2	9606.ENSP00000242249	0.711	Receptor activity-modifying protein 3
3	9606.ENSP00000264192	0.686	Cytohesin-interacting protein
4	9606.ENSP00000369618	0.686	FAST kinase domain-containing protein 5, mitochondrial
5	9606.ENSP00000317159	0.664	Cytochrome c1, heme protein, mitochondrial
6	9606.ENSP00000410339	0.662	Mitochondrial import receptor subunit TOM40 homolog
7	9606.ENSP00000232766	0.645	Kelch-like protein 18
8	9606.ENSP00000346067	0.637	40S ribosomal protein SA
9	9606.ENSP00000376139	0.632	Component of the autophagy machinery that controls the major intracellular degradation process by which cytoplasmic materials are packaged into autophagosomes and delivered to lysosomes for degradation . Binds phosphatidylinositol 3-phosphate (PtdIns3P) forming on membranes of the endoplasmic reticulum upon activation of the upstream ULK1 and PI3 kinases and is recruited at phagophore assembly sites where it regulates the elongation of nascent phagophores downstream of WIPI2 . In the cellular response to starvation, may also function together with the TSC1-TSC2 complex and RB1CC1 in th [...]
10	9606.ENSP00000417240	0.612	Ribosomal protein SA pseudogene 58
11	9606.ENSP00000314030	0.596	DnaJ homolog subfamily A member 2
12	9606.ENSP00000247843	0.595	YEATS domain-containing protein 4
13	9606.ENSP00000337445	0.579	Zinc phosphodiesterase ELAC protein 2
14	9606.ENSP00000384716	0.566	Probable palmitoyltransferase ZDHHC8
15	9606.ENSP00000346120	0.534	Nucleolar RNA helicase 2
16	9606.ENSP00000294129	0.529	NCK-interacting protein with SH3 domain
17	9606.ENSP00000384616	0.526	Major facilitator superfamily domain containing 7
18	9606.ENSP00000320038	0.514	Rho GTPase-activating protein 33
19	9606.ENSP00000260665	0.512	Leucine-rich PPR motif-containing protein, mitochondrial
20	9606.ENSP00000374529	0.509	Cyclin-K

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0008152	0.996	metabolic process
GO:0044237	0.986	cellular metabolic process
GO:0065007	0.985	biological regulation
GO:0044238	0.984	primary metabolic process
GO:0140053	0.979	mitochondrial gene expression
GO:0034641	0.975	cellular nitrogen compound metabolic process
GO:1903311	0.975	regulation of mRNA metabolic process
GO:0006396	0.969	RNA processing
GO:0009894	0.955	regulation of catabolic process
GO:0000959	0.947	mitochondrial RNA metabolic process
GO:0043488	0.947	regulation of mRNA stability
GO:0048518	0.873	positive regulation of biological process
GO:0048522	0.722	positive regulation of cellular process
GO:0000963	0.621	mitochondrial RNA processing
GO:0051726	0.549	regulation of cell cycle
GO:0016071	0.542	mRNA metabolic process
GO:0008284	0.476	positive regulation of cell population proliferation
GO:0044528	0.375	regulation of mitochondrial mRNA stability
GO:0006397	0.372	mRNA processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.992	intracellular organelle lumen
GO:0005634	0.699	nucleus
GO:0016020	0.525	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]