StarFunc result for job id Q96A09

User Input

>input (425 residues)
MMPSESGAERRDRAAAQVGTAAATAVATAAPAGGGPDPEALSAFPGRHLSGLSWPQVKRL
DALLSEPIPIHGRGNFPTLSVQPRQIVQVVRSTLEEQGLHVHSVRLHGSAASHVLHPESG
LGYKDLDLVFRVDLRSEASFQLTKAVVLACLLDFLPAGVSRAKITPLTLKEAYVQKLVKV
CTDSDRWSLISLSNKSGKNVELKFVDSVRRQFEFSIDSFQIILDSLLLFGQCSSTPMSEA
FHPTVTGESLYGDFTEALEHLRHRVIATRSPEEIRGGGLLKYCHLLVRGFRPRPSTDVRA
LQRYMCSRFFIDFPDLVEQRRTLERYLEAHFGGADAARRYACLVTLHRVVNESTVCLMNH
ERRQTLDLIAALALQALAEQGPAATAALAWRPPGTDGVVPATVNYYVTPVQPLLAHAYPT
WLPCN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96A09	1.000	1.000	8.576E-76	425	1.000	1.000	Q96A09.pdb.gz	TET5B_HUMAN Terminal nucleotidyltransferase 5B OS=Homo sapiens OX=9606 GN=TENT5B PE=1 SV=2
2	AFDB:D3Z5S8	0.795	0.756	1.117E-51	447	0.602	0.573	D3Z5S8.pdb.gz	TET5A_MOUSE Terminal nucleotidyltransferase 5A OS=Mus musculus OX=10090 GN=Tent5a PE=1 SV=2
3	AFDB:Q5SSF7	0.794	0.862	2.434E-50	391	0.558	0.606	Q5SSF7.pdb.gz	TET5C_MOUSE Terminal nucleotidyltransferase 5C OS=Mus musculus OX=10090 GN=Tent5c PE=1 SV=1
4	AFDB:Q8NEK8	0.767	0.837	1.639E-43	389	0.459	0.501	Q8NEK8.pdb.gz	TET5D_HUMAN Terminal nucleotidyltransferase 5D OS=Homo sapiens OX=9606 GN=TENT5D PE=1 SV=1
5	AFDB:A1Z743	0.780	0.383	8.279E-43	877	0.452	0.219	A1Z743.pdb.gz	A1Z743_DROME polynucleotide adenylyltransferase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG46385 PE=3 SV=1
6	AFDB:Q94K06	0.347	0.259	1.188E-4	605	0.113	0.079	Q94K06.pdb.gz	Q94K06_ARATH Polynucleotide adenylyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=At1g22660 PE=1 SV=1
7	PDB:6xz0A	0.186	0.288	2.012E-3	250	0.082	0.140	6xz0A.pdb.gz	Structural Recognition of Spectinomycin by Resistance Enzyme ANT(9) from Enterococcus faecalis.
8	PDB:3jyyB	0.184	0.248	2.479E-3	266	0.087	0.139	3jyyB.pdb.gz	Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB.
9	PDB:7buqA	0.147	0.160	9.641E-3	362	0.085	0.099	7buqA.pdb.gz	Mn2+Directly Activates cGAS and Structural Analysis Suggests Mn2+Induces a Noncanonical Catalytic Synthesis of 2'3'-cGAMP.
10	PDB:5n9yA	0.131	0.158	1.319E-2	327	0.094	0.122	5n9yA.pdb.gz
11	PDB:4e7xD	0.159	0.203	3.559E-2	320	0.038	0.050	4e7xD.pdb.gz
12	PDB:6y56A	0.195	0.243	3.559E-2	292	0.080	0.116	6y56A.pdb.gz
13	AFDB:F4JZI4	0.145	0.085	3.718E-2	818	0.073	0.038	F4JZI4.pdb.gz	F4JZI4_ARATH Squamosa promoter binding protein-like 7 OS=Arabidopsis thaliana OX=3702 GN=SPL7 PE=1 SV=1
14	PDB:3jcfA	0.119	0.137	3.749E-2	349	0.089	0.109	3jcfA.pdb.gz
15	AFDB:Q9HFP8	0.123	0.171	6.605E-2	284	0.054	0.081	Q9HFP8.pdb.gz	MP1_ASPFM Cell wall mannoprotein 1 OS=Aspergillus fumigatus OX=746128 GN=MP1 PE=1 SV=1
16	PDB:5wyjCB	0.148	0.068	7.394E-2	1098	0.087	0.034	5wyjCB.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
17	AFDB:E9RKC7	0.198	0.130	8.576E-2	764	0.078	0.043	E9RKC7.pdb.gz	E9RKC7_CAEEL DZF domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=zfr-1 PE=1 SV=1
18	PDB:4ud5B	0.165	0.199	9.112E-2	342	0.042	0.053	4ud5B.pdb.gz
19	PDB:7mq8NH	0.130	0.068	9.600E-2	1066	0.101	0.040	7mq8NH.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	AFDB:Q9VDS9	0.158	0.063	1.057E-1	1363	0.071	0.022	Q9VDS9.pdb.gz	Q9VDS9_DROME Apoptotic signal-regulating kinase 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Ask1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z5S8	0.0	520	447	0.598	0.568	TET5A_MOUSE Terminal nucleotidyltransferase 5A OS=Mus musculus OX=10090 GN=Tent5a PE=1 SV=2
2	Q96A09	0.0	869	425	1.000	1.000	TET5B_HUMAN Terminal nucleotidyltransferase 5B OS=Homo sapiens OX=9606 GN=TENT5B PE=1 SV=2
3	Q96IP4	0.0	516	442	0.593	0.570	TET5A_HUMAN Terminal nucleotidyltransferase 5A OS=Homo sapiens OX=9606 GN=TENT5A PE=1 SV=2
4	Q5VWP2	5.67e-175	496	391	0.572	0.621	TET5C_HUMAN Terminal nucleotidyltransferase 5C OS=Homo sapiens OX=9606 GN=TENT5C PE=1 SV=1
5	Q5SSF7	1.43e-172	490	391	0.567	0.616	TET5C_MOUSE Terminal nucleotidyltransferase 5C OS=Mus musculus OX=10090 GN=Tent5c PE=1 SV=1
6	Q8NEK8	2.44e-136	398	389	0.452	0.494	TET5D_HUMAN Terminal nucleotidyltransferase 5D OS=Homo sapiens OX=9606 GN=TENT5D PE=1 SV=1
7	A1Z745	1.23e-121	365	529	0.449	0.361	A1Z745_DROME polynucleotide adenylyltransferase OS=Drosophila melanogaster OX=7227 GN=CG45093 PE=3 SV=1
8	Q8SXN9	4.97e-121	365	560	0.449	0.341	Q8SXN9_DROME polynucleotide adenylyltransferase OS=Drosophila melanogaster OX=7227 GN=CG1383 PE=2 SV=1
9	A1Z743	3.83e-118	367	877	0.449	0.218	A1Z743_DROME polynucleotide adenylyltransferase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG46385 PE=3 SV=1
10	P34514	0.45	35.4	731	0.087	0.051	ANC2_CAEEL Anaphase-promoting complex subunit 2 OS=Caenorhabditis elegans OX=6239 GN=apc-2 PE=1 SV=3
11	X2JF83	4.9	32.3	5101	0.049	0.004	X2JF83_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
12	X2JKH9	4.9	32.3	5127	0.049	0.004	X2JKH9_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
13	X2JDY2	5.0	32.3	5116	0.049	0.004	X2JDY2_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
14	X2JFK0	5.0	32.3	5145	0.049	0.004	X2JFK0_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
15	Q9VXR3	5.1	32.3	5146	0.049	0.004	Q9VXR3_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=2
16	X2JC16	5.1	32.3	5150	0.049	0.004	X2JC16_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
17	X2JF73	5.1	32.3	5151	0.049	0.004	X2JF73_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
18	Q583D7	7.6	31.2	504	0.054	0.046	Q583D7_TRYB2 CSD domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.700 PE=4 SV=1
19	A0A096MJA1	8.0	31.6	967	0.064	0.028	A0A096MJA1_RAT Tyrosine-protein phosphatase non-receptor type OS=Rattus norvegicus OX=10116 GN=Ptpn3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07984 NTP_transf_7	2.2e-147	502.1	Nucleotidyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000289166

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331397	0.526	Protein FAM43B
2	9606.ENSP00000331211	0.514	RNA-binding protein 43
3	9606.ENSP00000376071	0.509	Protein FAM117B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004652	1.000	polynucleotide adenylyltransferase activity
GO:1990817	0.925	RNA adenylyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.991	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0060255	0.980	regulation of macromolecule metabolic process
GO:0080090	0.971	regulation of primary metabolic process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0031323	0.971	regulation of cellular metabolic process
GO:0010468	0.970	regulation of gene expression
GO:0048523	0.966	negative regulation of cellular process
GO:0010608	0.964	post-transcriptional regulation of gene expression
GO:0010604	0.932	positive regulation of macromolecule metabolic process
GO:0010628	0.911	positive regulation of gene expression
GO:0009889	0.825	regulation of biosynthetic process
GO:0051246	0.823	regulation of protein metabolic process
GO:0034250	0.791	positive regulation of amide metabolic process
GO:0010556	0.780	regulation of macromolecule biosynthetic process
GO:0031326	0.780	regulation of cellular biosynthetic process
GO:0006417	0.763	regulation of translation
GO:0048522	0.755	positive regulation of cellular process
GO:0045727	0.714	positive regulation of translation
GO:0010941	0.637	regulation of cell death
GO:0009987	0.625	cellular process
GO:0051726	0.623	regulation of cell cycle
GO:0042127	0.531	regulation of cell population proliferation
GO:0043067	0.531	regulation of programmed cell death
GO:0060548	0.510	negative regulation of cell death
GO:0043069	0.485	negative regulation of programmed cell death
GO:0042981	0.376	regulation of apoptotic process
GO:0043066	0.371	negative regulation of apoptotic process
GO:0071704	0.351	organic substance metabolic process
GO:0019219	0.326	regulation of nucleobase-containing compound metabolic process
GO:0044238	0.302	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0031981	0.957	nuclear lumen
GO:0005654	0.945	nucleoplasm
GO:0043232	0.305	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11332	1.000	ATP + RNA(n) = diphosphate + RNA(n)-3'-adenine ribonucleotide
EC:2.7.7.19	1.000	polynucleotide adenylyltransferase.

[back to server]