StarFunc result for job id Q96A26

User Input

>input (154 residues)
MGSLSGLRLAAGSCFRLCERDVSSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPL
HKPTDWQKKILIWSGRFKKEDEIPETVSLEMLDAAKNKMRVKISYLMIALTVVGCIFMVI
EGKKAAQRHETLTSLNLEKKARLKEEAAMKAKTE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96A26	1.000	1.000	1.422E-23	154	1.000	1.000	Q96A26.pdb.gz	F162A_HUMAN Protein FAM162A OS=Homo sapiens OX=9606 GN=FAM162A PE=1 SV=2
2	AFDB:Q9D6U8	0.749	0.745	2.992E-18	155	0.792	0.787	Q9D6U8.pdb.gz	F162A_MOUSE Protein FAM162A OS=Mus musculus OX=10090 GN=Fam162a PE=1 SV=1
3	AFDB:Q8WUD4	0.210	0.197	4.987E-1	166	0.175	0.163	Q8WUD4.pdb.gz	CCD12_HUMAN Coiled-coil domain-containing protein 12 OS=Homo sapiens OX=9606 GN=CCDC12 PE=1 SV=1
4	AFDB:Q9W0T5	0.203	0.044	1.581	956	0.123	0.020	Q9W0T5.pdb.gz	PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster OX=7227 GN=pyx PE=2 SV=2
5	AFDB:Q94AM8	0.195	0.177	1.699	172	0.162	0.145	Q94AM8.pdb.gz	Q94AM8_ARATH Ubiquitin-associated protein (DUF1068) OS=Arabidopsis thaliana OX=3702 GN=NKS1 PE=1 SV=1
6	AFDB:P53146	0.294	0.197	1.826	245	0.097	0.061	P53146.pdb.gz	USE1_YEAST Protein transport protein USE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=USE1 PE=1 SV=1
7	AFDB:Q587C6	0.198	0.042	1.962	1009	0.143	0.022	Q587C6.pdb.gz	Q587C6_TRYB2 Pre-mRNA splicing factor ATP-dependent RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.430 PE=4 SV=1
8	AFDB:O55166	0.192	0.059	2.436	723	0.169	0.036	O55166.pdb.gz	VPS52_RAT Vacuolar protein sorting-associated protein 52 homolog OS=Rattus norvegicus OX=10116 GN=Vps52 PE=1 SV=2
9	AFDB:Q502W7	0.240	0.078	2.436	563	0.175	0.048	Q502W7.pdb.gz	CCD38_HUMAN Coiled-coil domain-containing protein 38 OS=Homo sapiens OX=9606 GN=CCDC38 PE=2 SV=1
10	AFDB:Q8I4Q0	0.178	0.095	2.436	375	0.117	0.048	Q8I4Q0.pdb.gz	Q8I4Q0_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1253700 PE=4 SV=1
11	PDB:7ajtUN	0.181	0.189	3.019	147	0.123	0.129	7ajtUN.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
12	PDB:7v2wJ	0.149	0.100	4.028	236	0.156	0.102	7v2wJ.pdb.gz
13	PDB:7d4iRQ	0.177	0.091	6.208	339	0.110	0.050	7d4iRQ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
14	PDB:6rqhD	0.116	0.205	6.672	70	0.091	0.200	6rqhD.pdb.gz	Molecular insight into RNA polymerase I promoter recognition and promoter melting.
15	PDB:7d5tRQ	0.177	0.092	6.672	339	0.143	0.065	7d5tRQ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state F1)
16	PDB:7mqaLY	0.093	0.147	8.283	95	0.084	0.137	7mqaLY.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7mq8SS	0.181	0.146	8.902	197	0.143	0.112	7mq8SS.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96A26	1.54e-112	317	154	1.000	1.000	F162A_HUMAN Protein FAM162A OS=Homo sapiens OX=9606 GN=FAM162A PE=1 SV=2
2	F8W7Q4	1.83e-103	294	144	0.922	0.986	F8W7Q4_HUMAN Family with sequence similarity 162 member A OS=Homo sapiens OX=9606 GN=FAM162A PE=1 SV=1
3	E9PH05	1.30e-89	259	141	0.805	0.879	E9PH05_HUMAN Family with sequence similarity 162 member A OS=Homo sapiens OX=9606 GN=FAM162A PE=1 SV=1
4	Q9D6U8	1.65e-88	256	155	0.792	0.787	F162A_MOUSE Protein FAM162A OS=Mus musculus OX=10090 GN=Fam162a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06388 DUF1075	6.1e-51	183.0	Protein of unknown function (DUF1075)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419088

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361635	0.712	Voltage-dependent anion-selective channel protein 2
2	9606.ENSP00000362469	0.672	Solute carrier family 2, facilitated glucose transporter member 8
3	9606.ENSP00000219400	0.663	COX assembly mitochondrial protein 2 homolog
4	9606.ENSP00000355944	0.662	Kinetochore-associated protein NSL1 homolog
5	9606.ENSP00000347626	0.650	NudC domain containing 3
6	9606.ENSP00000296582	0.602	Transmembrane protein 184C
7	9606.ENSP00000356560	0.601	Uncharacterized protein KIAA1614
8	9606.ENSP00000244711	0.584	Male-enhanced antigen 1
9	9606.ENSP00000482657	0.583	Mitogen-activated protein kinase kinase kinase 14
10	9606.ENSP00000218004	0.582	NTF2-related export protein 2
11	9606.ENSP00000356567	0.581	Acyl-CoA-binding domain-containing protein 6
12	9606.ENSP00000397157	0.577	P53 apoptosis effector related to PMP-22
13	9606.ENSP00000421172	0.572	Acyl-CoA wax alcohol acyltransferase 2
14	9606.ENSP00000291458	0.569	Coiled-coil domain containing 58
15	9606.ENSP00000304854	0.562	NudC domain-containing protein 2
16	9606.ENSP00000381984	0.530	Regulation of nuclear pre-mRNA domain-containing protein 1A
17	9606.ENSP00000319169	0.525	Protein arginine N-methyltransferase 5
18	9606.ENSP00000261973	0.523	RNA-binding protein 25
19	9606.ENSP00000312625	0.504	Heterochromatin protein 1-binding protein 3
20	9606.ENSP00000314116	0.503	Transmembrane protein 107

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.986	biological regulation
GO:0009987	0.980	cellular process
GO:0050794	0.975	regulation of cellular process
GO:0048518	0.866	positive regulation of biological process
GO:0080090	0.861	regulation of primary metabolic process
GO:0050896	0.860	response to stimulus
GO:0048522	0.854	positive regulation of cellular process
GO:0051716	0.829	cellular response to stimulus
GO:0051171	0.823	regulation of nitrogen compound metabolic process
GO:0060255	0.818	regulation of macromolecule metabolic process
GO:0042981	0.768	regulation of apoptotic process
GO:0051173	0.743	positive regulation of nitrogen compound metabolic process
GO:0043085	0.742	positive regulation of catalytic activity
GO:0010604	0.721	positive regulation of macromolecule metabolic process
GO:0071456	0.710	cellular response to hypoxia
GO:0030162	0.689	regulation of proteolysis
GO:0051128	0.670	regulation of cellular component organization
GO:0051247	0.659	positive regulation of protein metabolic process
GO:0010822	0.647	positive regulation of mitochondrion organization
GO:0043065	0.603	positive regulation of apoptotic process
GO:0090199	0.574	regulation of release of cytochrome c from mitochondria
GO:0051336	0.536	regulation of hydrolase activity
GO:0052548	0.454	regulation of endopeptidase activity
GO:0008152	0.352	metabolic process
GO:0031323	0.323	regulation of cellular metabolic process
GO:2000116	0.300	regulation of cysteine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005829	0.999	cytosol
GO:0005634	0.700	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]