StarFunc result for job id Q96A32

User Input

>input (169 residues)
MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL
NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFL
EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04466	0.911	0.911	8.768E-27	169	0.959	0.959	P04466.pdb.gz	MYL11_RAT Myosin regulatory light chain 11 OS=Rattus norvegicus OX=10116 GN=Myl11 PE=1 SV=2
2	AFDB:A7XZM2	0.833	0.828	6.455E-23	170	0.793	0.788	A7XZM2.pdb.gz	A7XZM2_ONCMY Fast myosin light chain 2 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
3	AFDB:Q62082	0.580	0.495	2.676E-21	202	0.722	0.604	Q62082.pdb.gz	MYL10_MOUSE Myosin regulatory light chain 10 OS=Mus musculus OX=10090 GN=Myl10 PE=2 SV=1
4	AFDB:P08733	0.820	0.833	4.262E-21	166	0.728	0.741	P08733.pdb.gz	MLRV_RAT Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Rattus norvegicus OX=10116 GN=Myl2 PE=1 SV=2
5	AFDB:A0A060WU79	0.664	0.576	3.464E-20	200	0.627	0.530	A0A060WU79.pdb.gz	A0A060WU79_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039796001 PE=4 SV=1
6	AFDB:Q01449	0.862	0.834	6.198E-20	175	0.568	0.549	Q01449.pdb.gz	MLRA_HUMAN Myosin regulatory light chain 2, atrial isoform OS=Homo sapiens OX=9606 GN=MYL7 PE=1 SV=1
7	AFDB:Q7T2Y1	0.906	0.891	1.667E-19	172	0.568	0.558	Q7T2Y1.pdb.gz
8	AFDB:Q02045	0.883	0.864	2.656E-19	173	0.580	0.566	Q02045.pdb.gz	MYL5_HUMAN Myosin light chain 5 OS=Homo sapiens OX=9606 GN=MYL5 PE=2 SV=1
9	AFDB:Q9BUA6	0.646	0.503	1.013E-18	226	0.716	0.535	Q9BUA6.pdb.gz	MYL10_HUMAN Myosin regulatory light chain 10 OS=Homo sapiens OX=9606 GN=MYL10 PE=1 SV=2
10	PDB:7qioP	0.452	0.523	5.170E-17	143	0.834	0.986	7qioP.pdb.gz
11	AFDB:A0A0G2JSW0	0.841	0.827	7.512E-17	172	0.544	0.535	A0A0G2JSW0.pdb.gz	A0A0G2JSW0_RAT Myosin light chain 12A OS=Rattus norvegicus OX=10116 GN=Myl12b PE=4 SV=2
12	PDB:1i84U	0.737	0.888	2.617E-14	138	0.698	0.855	1i84U.pdb.gz
13	PDB:5tbyE	0.553	0.577	5.397E-13	160	0.669	0.706	5tbyE.pdb.gz
14	PDB:7mf3D	0.776	0.824	2.824E-11	158	0.509	0.544	7mf3D.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
15	PDB:3wfnB	0.439	0.439	1.912E-8	169	0.284	0.284	3wfnB.pdb.gz
16	PDB:1osaA	0.442	0.488	4.179E-7	148	0.254	0.291	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
17	PDB:6xu4A	0.394	0.181	6.281E-7	389	0.249	0.108	6xu4A.pdb.gz	FGCaMP7, an Improved Version of Fungi-Based Ratiometric Calcium Indicator for In Vivo Visualization of Neuronal Activity.
18	PDB:1ggzA	0.479	0.550	6.657E-7	144	0.278	0.326	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
19	PDB:5a2hA	0.477	0.537	7.927E-7	147	0.254	0.293	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
20	PDB:3fwbA	0.341	0.370	8.906E-7	153	0.254	0.281	3fwbA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96A32	1.26e-124	349	169	1.000	1.000	MYL11_HUMAN Myosin regulatory light chain 11 OS=Homo sapiens OX=9606 GN=MYL11 PE=1 SV=1
2	P04466	1.19e-119	336	169	0.959	0.959	MYL11_RAT Myosin regulatory light chain 11 OS=Rattus norvegicus OX=10116 GN=Myl11 PE=1 SV=2
3	P97457	5.17e-119	335	169	0.959	0.959	MYL11_MOUSE Myosin regulatory light chain 11 OS=Mus musculus OX=10090 GN=Myl11 PE=1 SV=3
4	P02609	5.19e-109	309	168	0.888	0.893	MYL11_CHICK Myosin regulatory light chain 11 OS=Gallus gallus OX=9031 GN=MYL11 PE=1 SV=2
5	O93409	1.24e-102	293	169	0.811	0.811	MLRSA_DANRE Myosin regulatory light chain 2, skeletal muscle isoform A OS=Danio rerio OX=7955 GN=mylpfa PE=1 SV=1
6	A7XZM2	1.20e-98	283	170	0.793	0.788	A7XZM2_ONCMY Fast myosin light chain 2 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
7	Q9I9H9	1.47e-95	275	170	0.763	0.759	Q9I9H9_ONCKI Myosin light chain 2 OS=Oncorhynchus kisutch OX=8019 PE=2 SV=1
8	P51667	2.86e-92	267	166	0.734	0.747	MLRV_MOUSE Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Mus musculus OX=10090 GN=Myl2 PE=1 SV=3
9	P08733	1.31e-91	265	166	0.728	0.741	MLRV_RAT Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Rattus norvegicus OX=10116 GN=Myl2 PE=1 SV=2
10	Q62082	1.83e-89	261	202	0.722	0.604	MYL10_MOUSE Myosin regulatory light chain 10 OS=Mus musculus OX=10090 GN=Myl10 PE=2 SV=1
11	A0A060XEV5	4.03e-89	258	149	0.704	0.799	A0A060XEV5_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00044007001 PE=4 SV=1
12	P10916	9.44e-89	258	166	0.710	0.723	MLRV_HUMAN Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Homo sapiens OX=9606 GN=MYL2 PE=1 SV=3
13	Q9BUA6	9.51e-82	243	226	0.716	0.535	MYL10_HUMAN Myosin regulatory light chain 10 OS=Homo sapiens OX=9606 GN=MYL10 PE=1 SV=2
14	A7XZM0	4.22e-73	219	168	0.586	0.589	A7XZM0_ONCMY Slow myosin light chain 2 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
15	A0A060WU79	4.70e-73	219	200	0.586	0.495	A0A060WU79_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039796001 PE=4 SV=1
16	Q801M3	5.04e-71	213	172	0.574	0.564	Q801M3_DANRE Myosin light chain 2 Mlc2a OS=Danio rerio OX=7955 GN=cmlc2 PE=1 SV=1
17	Q01449	7.64e-71	213	175	0.568	0.549	MLRA_HUMAN Myosin regulatory light chain 2, atrial isoform OS=Homo sapiens OX=9606 GN=MYL7 PE=1 SV=1
18	Q02045	9.72e-71	213	173	0.598	0.584	MYL5_HUMAN Myosin light chain 5 OS=Homo sapiens OX=9606 GN=MYL5 PE=2 SV=1
19	Q9QVP4	1.41e-70	213	175	0.556	0.537	MLRA_MOUSE Myosin regulatory light chain 2, atrial isoform OS=Mus musculus OX=10090 GN=Myl7 PE=1 SV=1
20	A0A060WH27	1.11e-69	209	149	0.556	0.631	A0A060WH27_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00071433001 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	1.1e-06	38.9	EF hand
2	PF13202 EF-hand_5	1.3	19.8	EF hand
3	PF13405 EF-hand_6	0.00014	32.5	EF-hand domain
4	PF13499 EF-hand_7	5.7e-05	34.8	EF-hand domain pair
5	PF13833 EF-hand_8	0.016	26.3	EF-hand domain pair

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325239

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307280	0.991	Myosin light chain 1/3, skeletal muscle isoform
2	9606.ENSP00000226207	0.980	Myosin-1
3	9606.ENSP00000353452	0.979	Myosin light chain kinase, smooth muscle
4	9606.ENSP00000404570	0.979	Myosin-13
5	9606.ENSP00000278317	0.969	Troponin T, fast skeletal muscle
6	9606.ENSP00000361636	0.967	Troponin C, skeletal muscle
7	9606.ENSP00000255381	0.966	Myosin-4
8	9606.ENSP00000470298	0.957	Myosin-14
9	9606.ENSP00000245503	0.956	Myosin-2
10	9606.ENSP00000384330	0.953	Myosin-8
11	9606.ENSP00000353590	0.952	Myosin-10
12	9606.ENSP00000371331	0.950	Troponin I, fast skeletal muscle
13	9606.ENSP00000347507	0.946	Myosin-7
14	9606.ENSP00000464317	0.945	Myosin-3
15	9606.ENSP00000386041	0.937	Myosin-6
16	9606.ENSP00000216181	0.936	Myosin-9
17	9606.ENSP00000446955	0.936	Myosin light polypeptide 6
18	9606.ENSP00000379616	0.931	Myosin-11
19	9606.ENSP00000450385	0.931	Myosin light chain 6B
20	9606.ENSP00000355645	0.919	Actin, alpha skeletal muscle

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008307	1.000	structural constituent of muscle
GO:0005515	1.000	protein binding
GO:0043167	0.687	ion binding
GO:0008092	0.468	cytoskeletal protein binding
GO:0046872	0.467	metal ion binding
GO:0005509	0.359	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.995	multicellular organismal process
GO:0048856	0.981	anatomical structure development
GO:0003012	0.951	muscle system process
GO:0006936	0.927	muscle contraction
GO:0009987	0.867	cellular process
GO:0065007	0.751	biological regulation
GO:0050789	0.691	regulation of biological process
GO:0061061	0.623	muscle structure development
GO:0048513	0.479	animal organ development
GO:0009888	0.451	tissue development
GO:0060537	0.436	muscle tissue development
GO:0007517	0.387	muscle organ development
GO:0050896	0.370	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0099080	1.000	supramolecular complex
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0099512	0.986	supramolecular fiber
GO:0005829	0.974	cytosol
GO:0043292	0.972	contractile fiber
GO:0030016	0.925	myofibril
GO:0043227	0.776	membrane-bounded organelle
GO:0032991	0.585	protein-containing complex
GO:0005856	0.429	cytoskeleton
GO:0043231	0.401	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]