StarFunc result for job id Q96A37

User Input

>input (237 residues)
MAMFRSLVASAQQRQPPAGPAGGDSGLEAQYTCPICLEVYHRPVAIGSCGHTFCGECLQP
CLQVPSPLCPLCRLPFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRVHISSCLKV
QEQMANCPKFVPVVPTSQPIPSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRV
VCPICSAMPWGDPSYKSANFLQHLLHRHKFSYDTFVDYSIDEEAAFQAALALSLSEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96A37	1.000	1.000	4.543E-50	237	1.000	1.000	Q96A37.pdb.gz	RN166_HUMAN E3 ubiquitin-protein ligase RNF166 OS=Homo sapiens OX=9606 GN=RNF166 PE=1 SV=1
2	AFDB:Q9Y508	0.413	0.428	9.517E-26	228	0.435	0.452	Q9Y508.pdb.gz	RN114_HUMAN E3 ubiquitin-protein ligase RNF114 OS=Homo sapiens OX=9606 GN=RNF114 PE=1 SV=1
3	AFDB:Q1L721	0.387	0.412	2.979E-20	222	0.312	0.333	Q1L721.pdb.gz	RN138_XENLA E3 ubiquitin-protein ligase RNF138 OS=Xenopus laevis OX=8355 GN=rnf138 PE=1 SV=1
4	AFDB:Q8WVD3	0.391	0.379	5.177E-19	245	0.312	0.302	Q8WVD3.pdb.gz	RN138_HUMAN E3 ubiquitin-protein ligase RNF138 OS=Homo sapiens OX=9606 GN=RNF138 PE=1 SV=1
5	AFDB:Q96EQ8	0.382	0.388	3.878E-16	232	0.312	0.319	Q96EQ8.pdb.gz	RN125_HUMAN E3 ubiquitin-protein ligase RNF125 OS=Homo sapiens OX=9606 GN=RNF125 PE=1 SV=4
6	AFDB:Q9D9R0	0.364	0.370	5.028E-16	233	0.321	0.326	Q9D9R0.pdb.gz	RN125_MOUSE E3 ubiquitin-protein ligase RNF125 OS=Mus musculus OX=10090 GN=Rnf125 PE=2 SV=3
7	AFDB:A0A096LP02	0.419	0.478	1.095E-15	206	0.312	0.359	A0A096LP02.pdb.gz	A0A096LP02_HUMAN E3 ubiquitin-protein ligase RNF114 OS=Homo sapiens OX=9606 GN=RNF114 PE=1 SV=1
8	AFDB:O00463	0.317	0.146	6.560E-10	557	0.207	0.088	O00463.pdb.gz	TRAF5_HUMAN TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2
9	AFDB:P70191	0.330	0.150	7.469E-10	558	0.253	0.108	P70191.pdb.gz	TRAF5_MOUSE TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1
10	AFDB:Q6DEG0	0.314	0.141	1.525E-9	573	0.194	0.080	Q6DEG0.pdb.gz	Q6DEG0_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=zgc:92367 PE=2 SV=1
11	PDB:5dkaA	0.355	0.824	9.615E-8	96	0.148	0.365	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:4r8pL	0.281	0.263	6.966E-6	254	0.101	0.094	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:5gm6a	0.241	0.437	1.173E-3	123	0.089	0.171	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:7jzvA	0.249	0.234	1.173E-3	253	0.080	0.075	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
15	PDB:8a3tU	0.189	0.354	5.219E-3	114	0.105	0.219	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
16	PDB:7qcdC	0.203	0.184	5.942E-3	267	0.080	0.071	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
17	PDB:7z36B	0.233	0.129	1.295E-2	446	0.089	0.047	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
18	PDB:2c2lA	0.233	0.198	4.163E-2	281	0.059	0.050	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
19	PDB:7oikA	0.200	0.014	5.058E-2	4426	0.084	0.005	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
20	PDB:3m62A	0.229	0.060	5.758E-2	955	0.038	0.009	3m62A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96A37	2.48e-178	490	237	1.000	1.000	RN166_HUMAN E3 ubiquitin-protein ligase RNF166 OS=Homo sapiens OX=9606 GN=RNF166 PE=1 SV=1
2	Q9Y508	2.90e-66	206	228	0.422	0.439	RN114_HUMAN E3 ubiquitin-protein ligase RNF114 OS=Homo sapiens OX=9606 GN=RNF114 PE=1 SV=1
3	Q1L721	9.23e-44	149	222	0.308	0.329	RN138_XENLA E3 ubiquitin-protein ligase RNF138 OS=Xenopus laevis OX=8355 GN=rnf138 PE=1 SV=1
4	Q8WVD3	2.69e-39	138	245	0.329	0.318	RN138_HUMAN E3 ubiquitin-protein ligase RNF138 OS=Homo sapiens OX=9606 GN=RNF138 PE=1 SV=1
5	Q9CQE0	3.44e-39	137	245	0.329	0.318	RN138_MOUSE E3 ubiquitin-protein ligase RNF138 OS=Mus musculus OX=10090 GN=Rnf138 PE=2 SV=1
6	A0A096LP02	6.96e-36	128	206	0.287	0.330	A0A096LP02_HUMAN E3 ubiquitin-protein ligase RNF114 OS=Homo sapiens OX=9606 GN=RNF114 PE=1 SV=1
7	A0A096LNV3	1.19e-35	127	188	0.283	0.356	A0A096LNV3_HUMAN E3 ubiquitin-protein ligase RNF114 (Fragment) OS=Homo sapiens OX=9606 GN=RNF114 PE=1 SV=1
8	Q96EQ8	3.51e-31	116	232	0.308	0.315	RN125_HUMAN E3 ubiquitin-protein ligase RNF125 OS=Homo sapiens OX=9606 GN=RNF125 PE=1 SV=4
9	Q9D9R0	2.00e-29	112	233	0.312	0.318	RN125_MOUSE E3 ubiquitin-protein ligase RNF125 OS=Mus musculus OX=10090 GN=Rnf125 PE=2 SV=3
10	Q9P0J7	1.29e-09	59.7	381	0.101	0.063	KCMF1_HUMAN E3 ubiquitin-protein ligase KCMF1 OS=Homo sapiens OX=9606 GN=KCMF1 PE=1 SV=2
11	Q7T1K2	4.37e-09	58.2	470	0.173	0.087	Q7T1K2_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=traf4l PE=2 SV=1
12	P70191	3.02e-08	55.8	558	0.122	0.052	TRAF5_MOUSE TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1
13	O74747	1.57e-07	53.5	387	0.118	0.072	RAD18_SCHPO Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp18 PE=3 SV=1
14	Q61382	2.68e-07	52.8	470	0.148	0.074	TRAF4_MOUSE TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2
15	Q9BUZ4	3.22e-07	52.8	470	0.148	0.074	TRAF4_HUMAN TNF receptor-associated factor 4 OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1
16	A0A2R8QTG3	3.34e-07	52.8	645	0.118	0.043	A0A2R8QTG3_DANRE E3 ubiquitin/ISG15 ligase TRIM25 isoform X1 OS=Danio rerio OX=7955 GN=zgc:55773 PE=1 SV=1
17	Q7ZVQ7	3.54e-07	52.8	654	0.118	0.043	Q7ZVQ7_DANRE E3 ubiquitin/ISG15 ligase TRIM25 OS=Danio rerio OX=7955 GN=zgc:55773 PE=1 SV=1
18	Q95RX5	4.15e-07	52.4	599	0.097	0.038	KCMF1_DROME E3 ubiquitin-protein ligase Kcmf1 OS=Drosophila melanogaster OX=7227 GN=Kcmf1 PE=1 SV=1
19	Q8RXD4	4.96e-07	52.4	941	0.093	0.023	BRCA1_ARATH Protein BREAST CANCER SUSCEPTIBILITY 1 homolog OS=Arabidopsis thaliana OX=3702 GN=BRCA1 PE=1 SV=1
20	F6SA91	5.63e-07	52.0	437	0.148	0.080	F6SA91_HUMAN TNF receptor-associated factor OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18912 DZR_2	35	15.7	Double zinc ribbon domain
2	PF14447 Prok-RING_4	17	16.7	Prokaryotic RING finger family 4
3	PF00301 Rubredoxin	7.3	18.0	Rubredoxin
4	PF04564 U-box	20	16.8	U-box domain
5	PF02809 UIM	9.2	17.4	Ubiquitin interaction motif
6	PF12861 zf-ANAPC11	75	14.8	Anaphase-promoting complex subunit 11 RING-H2 finger
7	PF13894 zf-C2H2_4	8.2e+02	12.3	C2H2-type zinc finger
8	PF00097 zf-C3HC4	0.0011	30.1	Zinc finger, C3HC4 type (RING finger)
9	PF13923 zf-C3HC4_2	3.2e-05	35.0	Zinc finger, C3HC4 type (RING finger)
10	PF13920 zf-C3HC4_3	0.0062	27.7	Zinc finger, C3HC4 type (RING finger)
11	PF15227 zf-C3HC4_4	8.2	17.9	zinc finger of C3HC4-type, RING
12	PF05605 zf-Di19	7.2e-14	63.1	Drought induced 19 protein (Di19), zinc-binding
13	PF12678 zf-rbx1	13	17.5	RING-H2 zinc finger domain
14	PF13248 zf-ribbon_3	86	14.0	zinc-ribbon domain
15	PF13639 zf-RING_2	0.0017	30.0	Ring finger domain
16	PF14634 zf-RING_5	0.0007	30.8	zinc-RING finger domain
17	PF14835 zf-RING_6	0.011	26.9	zf-RING of BARD1-type protein
18	PF13445 zf-RING_UBOX	7.7e-05	34.0	RING-type zinc-finger
19	PF18574 zf_C2HC_14	1.3e-09	49.0	C2HC Zing finger domain
20	PF18112 Zn-C2H2_12	31	16.3	Autophagy receptor zinc finger-C2H2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000015015

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000014842	0.712	Rap guanine nucleotide exchange factor (GEF) 2
2	60711.ENSCSAP00000005891	0.705	F-box and WD repeat domain containing 11
3	60711.ENSCSAP00000003041	0.657	Zinc finger protein 653
4	60711.ENSCSAP00000002326	0.653	annotation not available
5	60711.ENSCSAP00000018417	0.649	Zinc finger and BTB domain containing 39
6	60711.ENSCSAP00000014628	0.647	Zinc finger protein 827
7	60711.ENSCSAP00000013578	0.644	VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
8	60711.ENSCSAP00000002346	0.643	Family with sequence similarity 83, member F
9	60711.ENSCSAP00000005162	0.643	Zinc finger protein 692
10	60711.ENSCSAP00000007844	0.593	Ubiquitin-like modifier activating enzyme 3
11	60711.ENSCSAP00000002885	0.576	Poly [ADP-ribose] polymerase
12	60711.ENSCSAP00000004499	0.563	G1 to S phase transition 1
13	60711.ENSCSAP00000001838	0.562	Beta-transducin repeat containing E3 ubiquitin protein ligase
14	60711.ENSCSAP00000014759	0.561	Tubulin is the major constituent of microtubules. The gamma chain is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome
15	60711.ENSCSAP00000014781	0.561	Tubulin is the major constituent of microtubules. The gamma chain is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome
16	60711.ENSCSAP00000012398	0.558	RAB28, member RAS oncogene family
17	60711.ENSCSAP00000009022	0.555	Axin 1
18	60711.ENSCSAP00000013611	0.552	FtsJ RNA methyltransferase homolog 2 (E. coli)
19	60711.ENSCSAP00000010128	0.544	annotation not available
20	60711.ENSCSAP00000001256	0.535	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003824	0.964	catalytic activity
GO:0004842	0.954	ubiquitin-protein transferase activity
GO:0019899	0.799	enzyme binding
GO:0061630	0.528	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0009987	0.988	cellular process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0043170	0.984	macromolecule metabolic process
GO:1901564	0.980	organonitrogen compound metabolic process
GO:0050789	0.971	regulation of biological process
GO:0019538	0.967	protein metabolic process
GO:0050896	0.960	response to stimulus
GO:0050794	0.886	regulation of cellular process
GO:0016567	0.870	protein ubiquitination
GO:0044237	0.826	cellular metabolic process
GO:0019222	0.799	regulation of metabolic process
GO:0044265	0.726	cellular macromolecule catabolic process
GO:0048519	0.707	negative regulation of biological process
GO:0043632	0.707	modification-dependent macromolecule catabolic process
GO:0060255	0.685	regulation of macromolecule metabolic process
GO:0031323	0.541	regulation of cellular metabolic process
GO:0048583	0.501	regulation of response to stimulus
GO:0048523	0.477	negative regulation of cellular process
GO:0080090	0.470	regulation of primary metabolic process
GO:0051171	0.469	regulation of nitrogen compound metabolic process
GO:0030163	0.461	protein catabolic process
GO:0051716	0.432	cellular response to stimulus
GO:0010468	0.406	regulation of gene expression
GO:0048518	0.389	positive regulation of biological process
GO:0051603	0.387	proteolysis involved in protein catabolic process
GO:0009892	0.386	negative regulation of metabolic process
GO:0023051	0.384	regulation of signaling
GO:0010646	0.384	regulation of cell communication
GO:0010605	0.358	negative regulation of macromolecule metabolic process
GO:0009966	0.354	regulation of signal transduction
GO:0000209	0.340	protein polyubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.985	cytosol
GO:0005634	0.969	nucleus
GO:0016020	0.961	membrane
GO:0005886	0.859	plasma membrane
GO:0043228	0.683	non-membrane-bounded organelle
GO:0043232	0.499	intracellular non-membrane-bounded organelle
GO:0012505	0.393	endomembrane system
GO:0032991	0.319	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.954	Transferases.

[back to server]