StarFunc result for job id Q96A49

User Input

>input (352 residues)
MFRGLSSWLGLQQPVAGGGQPNGDAPPEQPSETVAESAEEELQQAGDQELLHQAKDFGNY
LFNFASAATKKITESVAETAQTIKKSVEEGKIDGIIDKTIIGDFQKEQKKFVEEQHTKKS
EAAVPPWVDTNDEETIQQQILALSADKRNFLRDPPAGVQFNFDFDQMYPVALVMLQEDEL
LSKMRFALVPKLVKEEVFWRNYFYRVSLIKQSAQLTALAAQQQAAGKEEKSNGREQDLPL
AEAVRPKTPPVVIKSQLKTQEDEEEISTSPGVSEFVSDAFDACNLNQEDLRKEMEQLVLD
KKQEETAVLEEDSADWEKELQQELQEYEVVTESEKRDENWDKEIEKMLQEEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96A49	1.000	1.000	2.584E-52	352	1.000	1.000	Q96A49.pdb.gz	SYAP1_HUMAN Synapse-associated protein 1 OS=Homo sapiens OX=9606 GN=SYAP1 PE=1 SV=1
2	AFDB:Q9D5V6	0.331	0.320	2.322E-39	365	0.847	0.816	Q9D5V6.pdb.gz	SYAP1_MOUSE Synapse-associated protein 1 OS=Mus musculus OX=10090 GN=Syap1 PE=1 SV=1
3	AFDB:Q960T2	0.279	0.189	1.818E-15	551	0.338	0.216	Q960T2.pdb.gz	SAP47_DROME Synapse-associated protein of 47 kDa OS=Drosophila melanogaster OX=7227 GN=Sap47 PE=1 SV=1
4	AFDB:F4JS91	0.264	0.292	2.085E-6	316	0.170	0.190	F4JS91.pdb.gz	F4JS91_ARATH BSD domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At4g13110 PE=1 SV=1
5	AFDB:O13905	0.204	0.207	3.665E-5	347	0.114	0.115	O13905.pdb.gz	YF3E_SCHPO BSD domain-containing protein C22A12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22A12.14c PE=1 SV=1
6	AFDB:P54858	0.255	0.288	6.346E-5	310	0.136	0.155	P54858.pdb.gz	DOS2_YEAST Protein DOS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DOS2 PE=1 SV=1
7	AFDB:Q9NW68	0.237	0.197	2.149E-4	430	0.136	0.112	Q9NW68.pdb.gz	BSDC1_HUMAN BSD domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BSDC1 PE=1 SV=1
8	AFDB:Q9QWI6	0.102	0.040	2.216E-2	1250	0.190	0.054	Q9QWI6.pdb.gz	SRCN1_MOUSE SRC kinase signaling inhibitor 1 OS=Mus musculus OX=10090 GN=Srcin1 PE=1 SV=2
9	AFDB:Q54BP6	0.117	0.061	1.658E-1	783	0.128	0.057	Q54BP6.pdb.gz	EXOC3_DICDI Exocyst complex component 3 OS=Dictyostelium discoideum OX=44689 GN=exoc3 PE=3 SV=1
10	AFDB:M9PC73	0.114	0.044	1.874E-1	1158	0.128	0.039	M9PC73.pdb.gz	M9PC73_DROME Liprin-alpha, isoform C OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
11	PDB:6o58A	0.102	0.121	8.172E-1	273	0.077	0.099	6o58A.pdb.gz
12	PDB:5n9yA	0.110	0.116	1.331	327	0.048	0.052	5n9yA.pdb.gz
13	PDB:4n4nA	0.120	0.088	1.415	504	0.048	0.034	4n4nA.pdb.gz	Structural Basis of Biological NO Generation by Octaheme Oxidoreductases.
14	PDB:2b5uA	0.110	0.085	1.504	470	0.071	0.053	2b5uA.pdb.gz
15	PDB:7lbmY	0.106	0.151	1.504	218	0.082	0.133	7lbmY.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
16	PDB:4o9yA	0.096	0.020	1.599	2490	0.114	0.016	4o9yA.pdb.gz
17	PDB:5dmnA	0.076	0.087	2.169	263	0.031	0.042	5dmnA.pdb.gz
18	PDB:7x3kA	0.090	0.119	2.305	262	0.037	0.050	7x3kA.pdb.gz
19	PDB:2a79B	0.138	0.169	2.942	259	0.060	0.081	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
20	PDB:3jcfA	0.072	0.072	3.127	349	0.054	0.054	3jcfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96A49	0.0	710	352	1.000	1.000	SYAP1_HUMAN Synapse-associated protein 1 OS=Homo sapiens OX=9606 GN=SYAP1 PE=1 SV=1
2	Q9D5V6	0.0	580	365	0.847	0.816	SYAP1_MOUSE Synapse-associated protein 1 OS=Mus musculus OX=10090 GN=Syap1 PE=1 SV=1
3	Q960T2	2.11e-48	172	551	0.347	0.221	SAP47_DROME Synapse-associated protein of 47 kDa OS=Drosophila melanogaster OX=7227 GN=Sap47 PE=1 SV=1
4	F4JS91	0.058	37.4	316	0.062	0.070	F4JS91_ARATH BSD domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At4g13110 PE=1 SV=1
5	Q6ZQ06	0.35	35.4	1403	0.062	0.016	CE162_MOUSE Centrosomal protein of 162 kDa OS=Mus musculus OX=10090 GN=Cep162 PE=1 SV=2
6	P54858	0.42	34.7	310	0.062	0.071	DOS2_YEAST Protein DOS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DOS2 PE=1 SV=1
7	P35606	2.7	32.7	906	0.065	0.025	COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2
8	O55029	3.5	32.3	905	0.065	0.025	COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus OX=10090 GN=Copb2 PE=1 SV=2
9	O35142	3.8	32.0	905	0.065	0.025	COPB2_RAT Coatomer subunit beta' OS=Rattus norvegicus OX=10116 GN=Copb2 PE=1 SV=3
10	P35605	3.9	32.0	906	0.065	0.025	COPB2_BOVIN Coatomer subunit beta' OS=Bos taurus OX=9913 GN=COPB2 PE=1 SV=3
11	A0A1D8PHB0	5.1	31.6	1126	0.060	0.019	A0A1D8PHB0_CANAL Serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC15 PE=4 SV=1
12	Q6JWU7	6.2	31.6	934	0.065	0.025	Q6JWU7_DANRE Coatomer subunit beta' OS=Danio rerio OX=7955 GN=sb:cb121 PE=1 SV=1
13	H0YJH6	7.0	31.2	865	0.051	0.021	H0YJH6_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT6 PE=1 SV=2
14	P42226	7.1	31.2	847	0.051	0.021	STAT6_HUMAN Signal transducer and activator of transcription 6 OS=Homo sapiens OX=9606 GN=STAT6 PE=1 SV=1
15	F8VR31	7.7	31.2	867	0.094	0.038	F8VR31_HUMAN DNA replication ATP-dependent helicase/nuclease OS=Homo sapiens OX=9606 GN=DNA2 PE=1 SV=3
16	P51530	9.6	30.8	1060	0.094	0.031	DNA2_HUMAN DNA replication ATP-dependent helicase/nuclease DNA2 OS=Homo sapiens OX=9606 GN=DNA2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03485 Arg_tRNA_synt_N	33	16.5	Arginyl tRNA synthetase N terminal domain
2	PF03909 BSD	6e-09	47.0	BSD domain
3	PF14968 CCDC84	3.2e+02	12.3	Coiled coil protein 84
4	PF01933 CofD	5.6e+02	11.2	2-phospho-L-lactate transferase CofD
5	PF10209 DUF2340	1.1e+02	14.7	Uncharacterized conserved protein (DUF2340)
6	PF10127 RlaP	1.5e+02	13.4	RNA repair pathway DNA polymerase beta family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369500

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401264	0.813	CTP synthase 2
2	9606.ENSP00000349824	0.798	RalBP1-associated Eps domain-containing protein 2
3	9606.ENSP00000314099	0.787	Carbonic anhydrase 5B, mitochondrial
4	9606.ENSP00000316357	0.735	Probable ubiquitin carboxyl-terminal hydrolase FAF-X
5	9606.ENSP00000368605	0.734	Acyl-coenzyme A thioesterase 9, mitochondrial
6	9606.ENSP00000444957	0.734	AP-1 complex subunit sigma-2
7	9606.ENSP00000369699	0.733	Collectrin
8	9606.ENSP00000303015	0.722	U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2
9	9606.ENSP00000468312	0.687	Echinoderm microtubule-associated protein-like 2
10	9606.ENSP00000247970	0.680	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
11	9606.ENSP00000253039	0.676	Eukaryotic translation initiation factor 2 subunit 3
12	9606.ENSP00000369643	0.673	Gastrin-releasing peptide receptor
13	9606.ENSP00000369465	0.635	Gamma-taxilin
14	9606.ENSP00000298198	0.625	Glucose 1,6-bisphosphate synthase
15	9606.ENSP00000259457	0.618	Proteasome subunit beta type-7
16	9606.ENSP00000290541	0.618	Proteasome subunit beta type-4
17	9606.ENSP00000271308	0.615	Proteasome subunit alpha type-5
18	9606.ENSP00000233627	0.571	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
19	9606.ENSP00000368927	0.555	Eukaryotic translation initiation factor 1A, X-chromosomal
20	9606.ENSP00000235628	0.543	Cytosolic 5'-nucleotidase 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.976	response to stimulus
GO:0065009	0.975	regulation of molecular function
GO:0051246	0.975	regulation of protein metabolic process
GO:0048522	0.972	positive regulation of cellular process
GO:0023052	0.969	signaling
GO:0007154	0.968	cell communication
GO:0051338	0.966	regulation of transferase activity
GO:0001932	0.966	regulation of protein phosphorylation
GO:0043549	0.964	regulation of kinase activity
GO:0051716	0.958	cellular response to stimulus
GO:0010033	0.953	response to organic substance
GO:0051173	0.945	positive regulation of nitrogen compound metabolic process
GO:0007165	0.945	signal transduction
GO:0031325	0.944	positive regulation of cellular metabolic process
GO:0010604	0.941	positive regulation of macromolecule metabolic process
GO:0051347	0.940	positive regulation of transferase activity
GO:0045860	0.933	positive regulation of protein kinase activity
GO:0045598	0.928	regulation of fat cell differentiation
GO:0031929	0.928	TOR signaling
GO:0070849	0.927	response to epidermal growth factor
GO:0071900	0.906	regulation of protein serine/threonine kinase activity
GO:0043434	0.862	response to peptide hormone
GO:0071495	0.839	cellular response to endogenous stimulus
GO:0071375	0.826	cellular response to peptide hormone stimulus
GO:0071902	0.812	positive regulation of protein serine/threonine kinase activity
GO:0051094	0.807	positive regulation of developmental process
GO:0071364	0.802	cellular response to epidermal growth factor stimulus
GO:0032869	0.799	cellular response to insulin stimulus
GO:0045600	0.796	positive regulation of fat cell differentiation
GO:0008152	0.400	metabolic process
GO:0071704	0.379	organic substance metabolic process
GO:0044237	0.329	cellular metabolic process
GO:0044238	0.327	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005794	0.998	Golgi apparatus
GO:0005654	0.997	nucleoplasm
GO:0005829	0.982	cytosol
GO:0031982	0.898	vesicle
GO:0005576	0.893	extracellular region
GO:0070062	0.738	extracellular exosome
GO:0030054	0.372	cell junction
GO:0042995	0.355	cell projection
GO:0120025	0.353	plasma membrane bounded cell projection
GO:0032991	0.339	protein-containing complex
GO:0098552	0.325	side of membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]