StarFunc result for job id Q96A54

User Input

>input (375 residues)
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEE
EEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPS
FRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA
VLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLS
IVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM
GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQE
FRYGLEGGCTDDTLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3V6I6	0.861	0.861	5.875E-48	375	0.973	0.973	G3V6I6.pdb.gz	G3V6I6_RAT Adiponectin receptor 1 OS=Rattus norvegicus OX=10116 GN=Adipor1 PE=3 SV=1
2	AFDB:B0S5Y2	0.835	0.830	7.984E-42	377	0.784	0.780	B0S5Y2.pdb.gz
3	AFDB:G3V707	0.770	0.748	3.744E-37	386	0.677	0.658	G3V707.pdb.gz	G3V707_RAT Adiponectin receptor 2 OS=Rattus norvegicus OX=10116 GN=Adipor2 PE=3 SV=1
4	AFDB:Q9VCY8	0.733	0.621	1.168E-27	444	0.499	0.421	Q9VCY8.pdb.gz	ADRL_DROME Adiponectin receptor protein OS=Drosophila melanogaster OX=7227 GN=AdipoR PE=1 SV=2
5	AFDB:Q9N536	0.704	0.455	2.124E-25	581	0.389	0.251	Q9N536.pdb.gz	Q9N536_CAEEL Adiponectin receptor protein OS=Caenorhabditis elegans OX=6239 GN=paqr-2 PE=1 SV=2
6	AFDB:Q94177	0.720	0.623	1.332E-24	434	0.413	0.357	Q94177.pdb.gz	ADRL_CAEEL Progestin and adipoQ receptor-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=paqr-1 PE=3 SV=2
7	AFDB:Q9SZG0	0.664	0.647	2.886E-19	385	0.315	0.306	Q9SZG0.pdb.gz	HHP4_ARATH Heptahelical transmembrane protein 4 OS=Arabidopsis thaliana OX=3702 GN=HHP4 PE=2 SV=1
8	AFDB:Q12442	0.709	0.835	1.221E-18	317	0.275	0.325	Q12442.pdb.gz	IZH2_YEAST ADIPOR-like receptor IZH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IZH2 PE=1 SV=2
9	AFDB:Q93ZH9	0.710	0.798	1.611E-17	332	0.256	0.289	Q93ZH9.pdb.gz	HHP1_ARATH Heptahelical transmembrane protein 1 OS=Arabidopsis thaliana OX=3702 GN=HHP1 PE=1 SV=1
10	AFDB:Q9ZUH8	0.686	0.747	1.683E-17	344	0.267	0.291	Q9ZUH8.pdb.gz	HHP3_ARATH Heptahelical transmembrane protein 3 OS=Arabidopsis thaliana OX=3702 GN=HHP3 PE=2 SV=2
11	PDB:7x9cR	0.340	0.398	6.026E-3	302	0.091	0.113	7x9cR.pdb.gz
12	PDB:5zbqA	0.308	0.264	1.064E-2	463	0.083	0.067	5zbqA.pdb.gz	Structural basis of ligand binding modes at the neuropeptide Y Y1receptor
13	PDB:4xesA	0.325	0.275	1.161E-2	471	0.088	0.070	4xesA.pdb.gz	Structural prerequisites for G-protein activation by the neurotensin receptor.
14	PDB:7jvqR	0.252	0.308	1.267E-2	286	0.080	0.105	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
15	PDB:7sqoR	0.382	0.488	2.050E-2	270	0.088	0.122	7sqoR.pdb.gz	Molecular mechanism of the wake-promoting agent TAK-925.
16	PDB:6osaR	0.309	0.343	2.441E-2	321	0.072	0.084	6osaR.pdb.gz	Conformational transitions of a neurotensin receptor 1-Gi1complex.
17	PDB:7f1qR	0.310	0.315	2.441E-2	367	0.099	0.101	7f1qR.pdb.gz
18	PDB:7ezmD	0.316	0.371	2.908E-2	304	0.083	0.102	7ezmD.pdb.gz	Ligand recognition and G-protein coupling selectivity of cholecystokinin A receptor
19	PDB:7tuzR	0.309	0.382	4.914E-2	284	0.069	0.092	7tuzR.pdb.gz	Structures of oxysterol sensor EBI2/GPR183, a key regulator of the immune response.
20	PDB:7vl9R	0.305	0.354	4.914E-2	302	0.099	0.123	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A3X9	0.0	679	355	0.869	0.918	A0A8I6A3X9_RAT Adiponectin receptor 1 OS=Rattus norvegicus OX=10116 GN=Adipor1 PE=3 SV=1
2	A0A8I6AFR8	0.0	646	348	0.877	0.945	A0A8I6AFR8_RAT Adiponectin receptor 1 OS=Rattus norvegicus OX=10116 GN=Adipor1 PE=3 SV=1
3	G3V6I6	0.0	760	375	0.973	0.973	G3V6I6_RAT Adiponectin receptor 1 OS=Rattus norvegicus OX=10116 GN=Adipor1 PE=3 SV=1
4	G3V707	0.0	531	386	0.696	0.676	G3V707_RAT Adiponectin receptor 2 OS=Rattus norvegicus OX=10116 GN=Adipor2 PE=3 SV=1
5	Q3YAF7	0.0	529	386	0.693	0.674	Q3YAF7_RAT Adiponectin receptor 2 OS=Rattus norvegicus OX=10116 GN=Adipor2 PE=2 SV=1
6	Q3YAF8	0.0	761	375	0.973	0.973	Q3YAF8_RAT Adiponectin receptor 1 OS=Rattus norvegicus OX=10116 GN=Adipor1 PE=2 SV=1
7	Q6P746	0.0	762	375	0.976	0.976	Q6P746_RAT Adiponectin receptor 1 OS=Rattus norvegicus OX=10116 GN=Adipor1 PE=2 SV=1
8	Q803Q0	0.0	600	377	0.792	0.788	Q803Q0_DANRE Adiponectin receptor 1b OS=Danio rerio OX=7955 GN=zgc:55386 PE=2 SV=1
9	Q86V24	0.0	540	386	0.688	0.668	PAQR2_HUMAN Adiponectin receptor protein 2 OS=Homo sapiens OX=9606 GN=ADIPOR2 PE=1 SV=1
10	Q8BQS5	0.0	533	386	0.696	0.676	PAQR2_MOUSE Adiponectin receptor protein 2 OS=Mus musculus OX=10090 GN=Adipor2 PE=1 SV=2
11	Q91VH1	0.0	756	375	0.968	0.968	PAQR1_MOUSE Adiponectin receptor protein 1 OS=Mus musculus OX=10090 GN=Adipor1 PE=1 SV=1
12	Q96A54	0.0	776	375	1.000	1.000	PAQR1_HUMAN Adiponectin receptor protein 1 OS=Homo sapiens OX=9606 GN=ADIPOR1 PE=1 SV=1
13	Q9VCY8	5.91e-133	389	444	0.493	0.417	ADRL_DROME Adiponectin receptor protein OS=Drosophila melanogaster OX=7227 GN=AdipoR PE=1 SV=2
14	Q94177	1.28e-112	337	434	0.427	0.369	ADRL_CAEEL Progestin and adipoQ receptor-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=paqr-1 PE=3 SV=2
15	Q9N536	2.67e-110	336	581	0.403	0.260	Q9N536_CAEEL Adiponectin receptor protein OS=Caenorhabditis elegans OX=6239 GN=paqr-2 PE=1 SV=2
16	Q12442	1.79e-53	181	317	0.277	0.328	IZH2_YEAST ADIPOR-like receptor IZH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IZH2 PE=1 SV=2
17	Q38A44	5.11e-49	169	307	0.275	0.336	Q38A44_TRYB2 Adiponectin receptor protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1100 PE=4 SV=1
18	Q93ZH9	4.11e-48	167	332	0.259	0.292	HHP1_ARATH Heptahelical transmembrane protein 1 OS=Arabidopsis thaliana OX=3702 GN=HHP1 PE=1 SV=1
19	Q9ZUH8	1.54e-46	164	344	0.269	0.294	HHP3_ARATH Heptahelical transmembrane protein 3 OS=Arabidopsis thaliana OX=3702 GN=HHP3 PE=2 SV=2
20	Q03419	1.49e-41	150	316	0.264	0.313	IZH1_YEAST ADIPOR-like receptor IZH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IZH1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14358 DUF4405	47	15.9	Domain of unknown function (DUF4405)
2	PF03006 HlyIII	4e-68	241.0	Haemolysin-III related
3	PF06127 Mpo1-like	86	14.6	2-hydroxy-palmitic acid dioxygenase Mpo1-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341785

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000288266	0.998	DCC-interacting protein 13-alpha
2	9606.ENSP00000389814	0.998	Adiponectin
3	9606.ENSP00000350928	0.921	Glutamate decarboxylase 1
4	9606.ENSP00000320886	0.913	Carbohydrate-responsive element-binding protein
5	9606.ENSP00000380432	0.859	Insulin
6	9606.ENSP00000312652	0.834	Leptin
7	9606.ENSP00000349616	0.805	Adiponectin receptor protein 2
8	9606.ENSP00000268613	0.800	Cadherin-13
9	9606.ENSP00000426909	0.762	Receptor of activated protein C kinase 1
10	9606.ENSP00000234313	0.749	Pleckstrin
11	9606.ENSP00000341940	0.720	Caveolin-3
12	9606.ENSP00000385523	0.720	Peroxisome proliferator-activated receptor alpha
13	9606.ENSP00000254101	0.711	5'-AMP-activated protein kinase subunit beta-2
14	9606.ENSP00000369081	0.698	Thioredoxin domain-containing protein 5
15	9606.ENSP00000228918	0.689	Tumor necrosis factor receptor superfamily member 3
16	9606.ENSP00000287878	0.689	5'-AMP-activated protein kinase subunit gamma-2
17	9606.ENSP00000371503	0.687	Complement C1q and tumor necrosis factor-related protein 9A
18	9606.ENSP00000360290	0.671	5'-AMP-activated protein kinase catalytic subunit alpha-2
19	9606.ENSP00000322242	0.664	RING finger protein 10
20	9606.ENSP00000287820	0.656	Peroxisome proliferator-activated receptor gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042562	1.000	hormone binding
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding
GO:0042802	0.441	identical protein binding
GO:0003824	0.329	catalytic activity
GO:0016500	0.310	protein-hormone receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071310	0.996	cellular response to organic substance
GO:0009719	0.995	response to endogenous stimulus
GO:0007165	0.995	signal transduction
GO:0019221	0.993	cytokine-mediated signaling pathway
GO:1904892	0.989	regulation of receptor signaling pathway via STAT
GO:0009755	0.988	hormone-mediated signaling pathway
GO:0048518	0.987	positive regulation of biological process
GO:0048522	0.981	positive regulation of cellular process
GO:0046425	0.981	regulation of receptor signaling pathway via JAK-STAT
GO:1900076	0.976	regulation of cellular response to insulin stimulus
GO:0046626	0.972	regulation of insulin receptor signaling pathway
GO:0048519	0.967	negative regulation of biological process
GO:0048523	0.964	negative regulation of cellular process
GO:0051128	0.943	regulation of cellular component organization
GO:0045926	0.919	negative regulation of growth
GO:0046628	0.918	positive regulation of insulin receptor signaling pathway
GO:0046427	0.918	positive regulation of receptor signaling pathway via JAK-STAT
GO:0030308	0.911	negative regulation of cell growth
GO:0019222	0.479	regulation of metabolic process
GO:0008152	0.440	metabolic process
GO:0031323	0.396	regulation of cellular metabolic process
GO:0071704	0.373	organic substance metabolic process
GO:0009893	0.356	positive regulation of metabolic process
GO:0080090	0.332	regulation of primary metabolic process
GO:0044238	0.306	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.528	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]