StarFunc result for job id Q96A56

User Input

>input (240 residues)
MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPT
EHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPME
NLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHT
TFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQYNY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QXE4	0.269	0.270	1.768E-26	239	0.875	0.879	Q9QXE4.pdb.gz	T53I1_MOUSE Tumor protein p53-inducible nuclear protein 1 OS=Mus musculus OX=10090 GN=Trp53inp1 PE=2 SV=1
2	AFDB:Q9PW56	0.101	0.093	1.131	265	0.150	0.136	Q9PW56.pdb.gz	BNP2_BOTJA Bradykinin-potentiating and C-type natriuretic peptides OS=Bothrops jararaca OX=8724 PE=1 SV=2
3	AFDB:Q8S3D2	0.098	0.070	2.351	373	0.171	0.110	Q8S3D2.pdb.gz	BH087_ARATH Transcription factor bHLH87 OS=Arabidopsis thaliana OX=3702 GN=BHLH87 PE=1 SV=1
4	AFDB:Q80TA9	0.095	0.017	4.004	2572	0.142	0.013	Q80TA9.pdb.gz	EPG5_MOUSE Ectopic P granules protein 5 homolog OS=Mus musculus OX=10090 GN=Epg5 PE=1 SV=2
5	AFDB:A0A1D8PF47	0.104	0.027	4.279	1234	0.138	0.027	A0A1D8PF47.pdb.gz	A0A1D8PF47_CANAL Chromatin-modulating protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GIN1 PE=4 SV=1
6	AFDB:Q4V3C5	0.133	0.075	4.279	509	0.129	0.061	Q4V3C5.pdb.gz	Q4V3C5_ARATH At4g22860 OS=Arabidopsis thaliana OX=3702 GN=TPXL3 PE=1 SV=1
7	AFDB:Q96JS3	0.093	0.041	5.584	809	0.125	0.037	Q96JS3.pdb.gz	PGBD1_HUMAN PiggyBac transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=PGBD1 PE=1 SV=1
8	AFDB:Q38AZ3	0.094	0.061	6.379	413	0.108	0.063	Q38AZ3.pdb.gz	Q38AZ3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0730 PE=4 SV=1
9	AFDB:A0A0S2Z5Z3	0.094	0.078	7.287	308	0.167	0.130	A0A0S2Z5Z3.pdb.gz	A0A0S2Z5Z3_HUMAN Chromosome 6 open reading frame 142 isoform 6 (Fragment) OS=Homo sapiens OX=9606 GN=C6orf142 PE=1 SV=1
10	AFDB:A8WGJ9	0.078	0.046	8.897	490	0.133	0.065	A8WGJ9.pdb.gz
11	PDB:3jb9A	0.089	0.017	9.595	1964	0.075	0.009	3jb9A.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96A56	0.0	498	240	1.000	1.000	T53I1_HUMAN Tumor protein p53-inducible nuclear protein 1 OS=Homo sapiens OX=9606 GN=TP53INP1 PE=1 SV=1
2	Q9QXE4	1.01e-147	413	239	0.875	0.879	T53I1_MOUSE Tumor protein p53-inducible nuclear protein 1 OS=Mus musculus OX=10090 GN=Trp53inp1 PE=2 SV=1
3	Q8CFU8	2.60e-22	93.2	221	0.263	0.285	T53I2_MOUSE Tumor protein p53-inducible nuclear protein 2 OS=Mus musculus OX=10090 GN=Tp53inp2 PE=2 SV=4
4	Q8IXH6	1.10e-18	83.6	220	0.242	0.264	T53I2_HUMAN Tumor protein p53-inducible nuclear protein 2 OS=Homo sapiens OX=9606 GN=TP53INP2 PE=1 SV=2
5	M9NFM7	1.02e-13	72.0	417	0.283	0.163	M9NFM7_DROME Diabetes and obesity regulated, isoform G OS=Drosophila melanogaster OX=7227 GN=TP53INP PE=1 SV=1
6	Q5QRU6	7.6	29.3	151	0.092	0.146	Q5QRU6_CHICK Eye-globin OS=Gallus gallus OX=9031 GN=GBE PE=2 SV=1
7	Q92608	9.8	30.0	1830	0.067	0.009	DOCK2_HUMAN Dedicator of cytokinesis protein 2 OS=Homo sapiens OX=9606 GN=DOCK2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14839 DOR	9e-88	305.7	DOR family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344215

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.936	Cellular tumor antigen p53
2	9606.ENSP00000385571	0.904	Homeodomain-interacting protein kinase 2
3	9606.ENSP00000378217	0.777	Protein kinase C delta type
4	9606.ENSP00000379003	0.764	Nuclear protein 1, transcriptional regulator
5	9606.ENSP00000037243	0.751	Gamma-aminobutyric acid receptor-associated protein-like 2
6	9606.ENSP00000306866	0.609	Gamma-aminobutyric acid receptor-associated protein
7	9606.ENSP00000463188	0.604	Tripartite motif-containing protein 16
8	9606.ENSP00000247970	0.602	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
9	9606.ENSP00000302961	0.543	Heat shock protein family A member 4
10	9606.ENSP00000263735	0.540	Epithelial cell adhesion molecule
11	9606.ENSP00000330032	0.518	Uridine phosphorylase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0016209	0.983	antioxidant activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.992	cellular process
GO:0031325	0.988	positive regulation of cellular metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0080090	0.971	regulation of primary metabolic process
GO:0060255	0.968	regulation of macromolecule metabolic process
GO:0010604	0.955	positive regulation of macromolecule metabolic process
GO:0010468	0.953	regulation of gene expression
GO:0050896	0.872	response to stimulus
GO:0048519	0.782	negative regulation of biological process
GO:0051716	0.769	cellular response to stimulus
GO:0009889	0.750	regulation of biosynthetic process
GO:0010556	0.744	regulation of macromolecule biosynthetic process
GO:0019219	0.743	regulation of nucleobase-containing compound metabolic process
GO:0051173	0.736	positive regulation of nitrogen compound metabolic process
GO:0031326	0.723	regulation of cellular biosynthetic process
GO:0048523	0.700	negative regulation of cellular process
GO:0006355	0.698	regulation of DNA-templated transcription
GO:0006950	0.665	response to stress
GO:0012501	0.587	programmed cell death
GO:0033554	0.565	cellular response to stress
GO:0009894	0.554	regulation of catabolic process
GO:0010605	0.544	negative regulation of macromolecule metabolic process
GO:0045935	0.538	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.533	positive regulation of cellular biosynthetic process
GO:1902680	0.496	positive regulation of RNA biosynthetic process
GO:0045893	0.476	positive regulation of DNA-templated transcription
GO:0031329	0.451	regulation of cellular catabolic process
GO:0042221	0.442	response to chemical
GO:0008152	0.422	metabolic process
GO:0042981	0.398	regulation of apoptotic process
GO:0051726	0.380	regulation of cell cycle
GO:0031331	0.356	positive regulation of cellular catabolic process
GO:0042127	0.343	regulation of cell population proliferation
GO:0071704	0.308	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005634	0.995	nucleus
GO:0005654	0.985	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]