StarFunc result for job id Q96A59

User Input

>input (401 residues)
MEDPSGAREPRARPRERDPGRRPHPDQGRTHDRPRDRPGDPRRKRSSDGNRRRDGDRDPE
RDQERDGNRDRNRDRERERERERDPDRGPRRDTHRDAGPRAGEHGVWEKPRQSRTRDGAR
GLTWDAAAPPGPAPWEAPEPPQPQRKGDPGRRRPESEPPSERYLPSTPRPGREEVEYYQS
EAEGLLECHKCKYLCTGRACCQMLEVLLNLLILACSSVSYSSTGGYTGITSLGGIYYYQF
GGAYSGFDGADGEKAQQLDVQFYQLKLPMVTVAMACSGALTALCCLFVAMGVLRVPWHCP
LLLVTEGLLDMLIAGGYIPALYFYFHYLSAAYGSPVCKERQALYQSKGYSGFGCSFHGAD
IGAGIFAALGIVVFALGAVLAIKGYRKVRKLKEKPAEMFEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96A59	1.000	1.000	8.187E-52	401	1.000	1.000	Q96A59.pdb.gz	MALD3_HUMAN MARVEL domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MARVELD3 PE=2 SV=3
2	AFDB:M9YY17	0.289	0.214	9.633E-6	569	0.190	0.134	M9YY17.pdb.gz	M9YY17_ONCMY Tricellulin (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
3	AFDB:Q7Z429	0.122	0.129	3.822E-2	371	0.120	0.129	Q7Z429.pdb.gz	LFG1_HUMAN Protein lifeguard 1 OS=Homo sapiens OX=9606 GN=GRINA PE=1 SV=1
4	AFDB:O75385	0.092	0.046	1.010E-1	1050	0.117	0.045	O75385.pdb.gz	ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens OX=9606 GN=ULK1 PE=1 SV=2
5	PDB:7ocaI	0.154	0.268	2.053E-1	185	0.072	0.157	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
6	AFDB:Q16891	0.147	0.086	2.176E-1	758	0.095	0.050	Q16891.pdb.gz	MIC60_HUMAN MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT PE=1 SV=1
7	PDB:6ov2A	0.155	0.289	2.651E-1	182	0.077	0.170	6ov2A.pdb.gz
8	AFDB:P30803	0.133	0.060	2.670E-1	1265	0.165	0.052	P30803.pdb.gz	ADCY5_CANLF Adenylate cyclase type 5 OS=Canis lupus familiaris OX=9615 GN=ADCY5 PE=1 SV=2
9	AFDB:Q93971	0.100	0.030	2.810E-1	2032	0.142	0.028	Q93971.pdb.gz	TRPG_CAEEL Transient receptor potential channel OS=Caenorhabditis elegans OX=6239 GN=gon-2 PE=1 SV=4
10	AFDB:Q9QY01	0.098	0.045	3.276E-1	1037	0.142	0.055	Q9QY01.pdb.gz	ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus OX=10090 GN=Ulk2 PE=1 SV=1
11	AFDB:Q9VU14	0.108	0.060	4.019E-1	835	0.155	0.074	Q9VU14.pdb.gz	Q9VU14_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Atg1 PE=2 SV=1
12	AFDB:Q3KR86	0.113	0.084	4.452E-1	609	0.092	0.061	Q3KR86.pdb.gz	MIC60_RAT MICOS complex subunit Mic60 (Fragment) OS=Rattus norvegicus OX=10116 GN=Immt PE=1 SV=1
13	PDB:5vkqA	0.124	0.040	4.654E-1	1499	0.075	0.020	5vkqA.pdb.gz
14	PDB:7bylA	0.136	0.149	4.898E-1	354	0.097	0.110	7bylA.pdb.gz	Structural Basis for the Modulation of Human KCNQ4 by Small-Molecule Drugs.
15	PDB:6xz6A	0.171	0.286	5.155E-1	213	0.055	0.103	6xz6A.pdb.gz
16	PDB:1tr2B	0.102	0.050	5.426E-1	1029	0.067	0.026	1tr2B.pdb.gz
17	PDB:7vnrA	0.140	0.163	7.762E-1	333	0.105	0.126	7vnrA.pdb.gz	Structural insights into the lipid and ligand regulation of a human neuronal KCNQ channel.
18	PDB:7rz4A	0.202	0.102	8.169E-1	993	0.060	0.024	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
19	PDB:7p5jA	0.094	0.095	8.598E-1	399	0.070	0.070	7p5jA.pdb.gz
20	PDB:6u84A	0.084	0.059	1.362	630	0.057	0.037	6u84A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96A59	0.0	812	401	1.000	1.000	MALD3_HUMAN MARVEL domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MARVELD3 PE=2 SV=3
2	Q9D956	6.33e-141	408	376	0.601	0.641	MALD3_MOUSE MARVEL domain-containing protein 3 OS=Mus musculus OX=10090 GN=Marveld3 PE=2 SV=1
3	F1QBY1	3.50e-10	64.7	2876	0.097	0.014	NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio OX=7955 GN=nipblb PE=2 SV=1
4	F1RAH8	8.36e-09	59.3	450	0.137	0.122	F1RAH8_DANRE RNA-binding motif protein X-linked 2 OS=Danio rerio OX=7955 GN=im:7141316 PE=4 SV=1
5	Q4QRG7	8.14e-07	53.1	434	0.110	0.101	Q4QRG7_DANRE RNA-binding motif protein, X-linked 2 OS=Danio rerio OX=7955 GN=zgc:113884 PE=2 SV=1
6	Q6PGZ3	3.86e-04	45.1	629	0.065	0.041	MIPT3_DANRE TRAF3-interacting protein 1 OS=Danio rerio OX=7955 GN=traf3ip1 PE=2 SV=1
7	Q99590	0.001	43.9	1463	0.080	0.022	SCAFB_HUMAN Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2
8	F8VXG7	0.002	43.1	1271	0.080	0.025	F8VXG7_HUMAN SR-related CTD associated factor 11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=1
9	Q9LFE0	0.002	42.7	820	0.082	0.040	DOT2_ARATH SART-1 family protein DOT2 OS=Arabidopsis thaliana OX=3702 GN=DOT2 PE=1 SV=1
10	C6KTD3	0.008	40.8	1129	0.050	0.018	C6KTD3_PLAF7 Cullin-like protein, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0629800 PE=3 SV=1
11	B7YZQ3	0.011	40.4	1235	0.107	0.035	B7YZQ3_DROME Prominin, isoform D OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=1
12	O23212	0.032	38.9	573	0.060	0.042	U2A2A_ARATH Splicing factor U2af large subunit A OS=Arabidopsis thaliana OX=3702 GN=U2AF65A PE=1 SV=2
13	Q9VQ76	0.042	38.9	1641	0.072	0.018	Q9VQ76_DROME THO complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=tho2 PE=1 SV=2
14	E2QCS8	0.061	38.1	1642	0.057	0.014	E2QCS8_DROME THO complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=tho2 PE=1 SV=1
15	M9PE28	0.061	38.1	1641	0.057	0.014	M9PE28_DROME THO complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=tho2 PE=1 SV=1
16	Q5LJZ2	0.15	37.0	1641	0.055	0.013	SET1_DROME Histone-lysine N-methyltransferase SETD1 OS=Drosophila melanogaster OX=7227 GN=Set1 PE=1 SV=1
17	P12259	0.17	37.0	2224	0.100	0.018	FA5_HUMAN Coagulation factor V OS=Homo sapiens OX=9606 GN=F5 PE=1 SV=4
18	E9PSL7	0.18	36.6	2055	0.067	0.013	CTRO_RAT Citron rho-interacting kinase OS=Rattus norvegicus OX=10116 GN=Cit PE=1 SV=1
19	P49025	0.20	36.6	2055	0.067	0.013	CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus OX=10090 GN=Cit PE=1 SV=3
20	Q09779	0.42	35.4	1628	0.090	0.022	THO2_SCHPO THO complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tho2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10177 DUF2371	8.5e+02	11.5	Uncharacterised conserved protein (DUF2371)
2	PF01284 MARVEL	0.00031	32.3	Membrane-associating domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9694.XP_007075007.1

Rank	PPI partner	STRING score	Description
1	9694.XP_007080066.1	0.844	Mitogen-activated protein kinase kinase kinase 1
2	9694.XP_007079930.1	0.708	MARVEL domain-containing protein 2
3	9694.XP_007079929.1	0.674	Occludin
4	9694.XP_007089958.1	0.525	GTP-binding protein Di-Ras3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031435	1.000	mitogen-activated protein kinase kinase kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050789	0.979	regulation of biological process
GO:0045216	0.967	cell-cell junction organization
GO:0050794	0.965	regulation of cellular process
GO:0048519	0.953	negative regulation of biological process
GO:0042127	0.950	regulation of cell population proliferation
GO:0030336	0.936	negative regulation of cell migration
GO:0048583	0.928	regulation of response to stimulus
GO:0050678	0.915	regulation of epithelial cell proliferation
GO:0050680	0.860	negative regulation of epithelial cell proliferation
GO:0051239	0.838	regulation of multicellular organismal process
GO:0051241	0.817	negative regulation of multicellular organismal process
GO:0010632	0.810	regulation of epithelial cell migration
GO:0010633	0.804	negative regulation of epithelial cell migration
GO:0080134	0.783	regulation of response to stress
GO:0007043	0.746	cell-cell junction assembly
GO:0050896	0.742	response to stimulus
GO:0051179	0.719	localization
GO:0048585	0.662	negative regulation of response to stimulus
GO:0009966	0.629	regulation of signal transduction
GO:1902532	0.604	negative regulation of intracellular signal transduction
GO:0070302	0.576	regulation of stress-activated protein kinase signaling cascade
GO:0070303	0.572	negative regulation of stress-activated protein kinase signaling cascade
GO:0120192	0.519	tight junction assembly
GO:0043297	0.499	apical junction assembly
GO:0032872	0.459	regulation of stress-activated MAPK cascade
GO:0043409	0.459	negative regulation of MAPK cascade
GO:0032873	0.453	negative regulation of stress-activated MAPK cascade
GO:0070727	0.415	cellular macromolecule localization
GO:0008104	0.413	protein localization
GO:0006950	0.353	response to stress
GO:0070830	0.332	bicellular tight junction assembly
GO:0009628	0.329	response to abiotic stimulus
GO:1902414	0.324	protein localization to cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005923	1.000	bicellular tight junction
GO:0005737	0.998	cytoplasm
GO:0043227	0.997	membrane-bounded organelle
GO:0043229	0.995	intracellular organelle
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0031982	0.968	vesicle
GO:0031410	0.856	cytoplasmic vesicle
GO:0016020	0.550	membrane
GO:0071944	0.501	cell periphery
GO:0005886	0.451	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]