StarFunc result for job id Q96A72

User Input

>input (148 residues)
MAVASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVME
ELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEG
LRVFYYLVQDLKCLVFSLIGLHFKIKPI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1M0X6	0.997	0.997	2.434E-29	148	0.993	0.993	F1M0X6.pdb.gz	F1M0X6_RAT Mago homolog B, exon junction complex subunit OS=Rattus norvegicus OX=10116 GN=Magohb PE=3 SV=2
2	AFDB:P49028	0.983	0.990	1.746E-27	147	0.885	0.891	P49028.pdb.gz	MGN_DROME Protein mago nashi OS=Drosophila melanogaster OX=7227 GN=mago PE=1 SV=1
3	AFDB:O23676	0.980	0.967	2.433E-26	150	0.777	0.767	O23676.pdb.gz	MGN_ARATH Protein mago nashi homolog OS=Arabidopsis thaliana OX=3702 GN=MAGO PE=1 SV=1
4	AFDB:P49029	0.972	0.947	1.494E-25	152	0.791	0.770	P49029.pdb.gz	MGN_CAEEL Protein mago nashi homolog OS=Caenorhabditis elegans OX=6239 GN=mag-1 PE=1 SV=2
5	AFDB:P49030	0.939	0.870	5.741E-25	160	0.804	0.744	P49030.pdb.gz	MGN2_ORYSJ Protein mago nashi homolog 2 OS=Oryza sativa subsp. japonica OX=39947 GN=MAGO2 PE=1 SV=2
6	PDB:5xjcv	0.933	0.958	6.324E-25	144	0.973	1.000	5xjcv.pdb.gz	An Atomic Structure of the Human Spliceosome
7	PDB:2x1gB	0.907	0.958	2.527E-23	140	0.851	0.900	2x1gB.pdb.gz
8	AFDB:O43037	0.931	0.938	5.629E-21	147	0.608	0.612	O43037.pdb.gz	MGN_SCHPO Protein mago nashi homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnh1 PE=3 SV=1
9	AFDB:Q586G7	0.906	0.912	3.593E-19	147	0.527	0.531	Q586G7.pdb.gz	Q586G7_TRYB2 Mago nashi-like protein,putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.30P15.540 PE=3 SV=1
10	AFDB:Q5EBX5	0.217	0.042	1.922E-2	961	0.108	0.017	Q5EBX5.pdb.gz	Q5EBX5_MOUSE Mini-agrin OS=Mus musculus OX=10090 GN=Agrn PE=2 SV=1
11	PDB:5dg2B	0.152	0.163	2.244E-2	131	0.088	0.099	5dg2B.pdb.gz	Human galectin-2 interacts with carbohydrates and peptides non-classically: new insight from X-ray crystallography and hemagglutination.
12	AFDB:Q47N25	0.181	0.188	3.255E-2	138	0.068	0.072	Q47N25.pdb.gz	SSGB_THEFY Sporulation-specific cell division protein SsgB OS=Thermobifida fusca (strain YX) OX=269800 GN=ssgB PE=1 SV=1
13	AFDB:O65931	0.170	0.036	5.845E-2	970	0.074	0.011	O65931.pdb.gz	O65931_MYCTU Probable arylsulfatase AtsB (Aryl-sulfate sulphohydrolase) (Sulfatase) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=atsB PE=1 SV=3
14	PDB:3cm1A	0.176	0.184	7.237E-2	137	0.081	0.088	3cm1A.pdb.gz
15	PDB:1cd1A	0.208	0.135	8.626E-2	273	0.122	0.066	1cd1A.pdb.gz
16	PDB:4ga9A	0.157	0.165	1.028E-1	134	0.095	0.104	4ga9A.pdb.gz	Gal-1 structure analysis
17	PDB:1iwmA	0.186	0.166	1.090E-1	177	0.074	0.062	1iwmA.pdb.gz
18	PDB:3zxfB	0.168	0.176	1.090E-1	138	0.081	0.087	3zxfB.pdb.gz
19	PDB:3jcfA	0.159	0.087	1.156E-1	349	0.176	0.074	3jcfA.pdb.gz
20	PDB:7oikA	0.164	0.016	1.300E-1	4426	0.149	0.005	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96A72	6.38e-108	305	148	1.000	1.000	MGN2_HUMAN Protein mago nashi homolog 2 OS=Homo sapiens OX=9606 GN=MAGOHB PE=1 SV=1
2	F1M0X6	1.98e-107	304	148	0.993	0.993	F1M0X6_RAT Mago homolog B, exon junction complex subunit OS=Rattus norvegicus OX=10116 GN=Magohb PE=3 SV=2
3	P61326	9.84e-105	297	146	0.973	0.986	MGN_HUMAN Protein mago nashi homolog OS=Homo sapiens OX=9606 GN=MAGOH PE=1 SV=1
4	P49028	7.14e-96	275	147	0.885	0.891	MGN_DROME Protein mago nashi OS=Drosophila melanogaster OX=7227 GN=mago PE=1 SV=1
5	P49030	4.71e-87	253	160	0.804	0.744	MGN2_ORYSJ Protein mago nashi homolog 2 OS=Oryza sativa subsp. japonica OX=39947 GN=MAGO2 PE=1 SV=2
6	P49029	6.79e-86	249	152	0.791	0.770	MGN_CAEEL Protein mago nashi homolog OS=Caenorhabditis elegans OX=6239 GN=mag-1 PE=1 SV=2
7	O23676	5.40e-84	244	150	0.764	0.753	MGN_ARATH Protein mago nashi homolog OS=Arabidopsis thaliana OX=3702 GN=MAGO PE=1 SV=1
8	O43037	1.04e-65	198	147	0.608	0.612	MGN_SCHPO Protein mago nashi homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnh1 PE=3 SV=1
9	Q586G7	4.31e-53	166	147	0.520	0.524	Q586G7_TRYB2 Mago nashi-like protein,putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.30P15.540 PE=3 SV=1
10	P9WJM9	1.7	30.8	414	0.203	0.072	MSHC_MYCTU L-cysteine:1D-myo-inositol 2-amino-2-deoxy-alpha-D-glucopyranoside ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mshC PE=1 SV=1
11	Q9SUG3	1.8	30.8	353	0.095	0.040	ITPK3_ARATH Inositol-tetrakisphosphate 1-kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ITPK3 PE=1 SV=2
12	O74405	5.5	29.3	381	0.108	0.042	SET11_SCHPO Ribosomal lysine N-methyltransferase set11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02792 Mago_nashi	5.2e-74	258.4	Mago nashi protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000319240

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264645	0.999	Protein CASC3
2	9606.ENSP00000269349	0.999	Eukaryotic initiation factor 4A-III
3	9606.ENSP00000463058	0.999	RNA-binding protein 8A
4	9606.ENSP00000266735	0.998	Small nuclear ribonucleoprotein F
5	9606.ENSP00000386156	0.997	Partner of Y14 and mago
6	9606.ENSP00000400591	0.997	Small nuclear ribonucleoprotein E
7	9606.ENSP00000272348	0.996	Small nuclear ribonucleoprotein G
8	9606.ENSP00000387006	0.995	Pre-mRNA-splicing factor CWC22 homolog
9	9606.ENSP00000215829	0.992	Small nuclear ribonucleoprotein Sm D3
10	9606.ENSP00000342374	0.992	Small nuclear ribonucleoprotein Sm D2
11	9606.ENSP00000300413	0.991	Small nuclear ribonucleoprotein Sm D1
12	9606.ENSP00000246071	0.990	U2 small nuclear ribonucleoprotein B'
13	9606.ENSP00000360525	0.989	Protein mago nashi homolog
14	9606.ENSP00000392094	0.989	116 kDa U5 small nuclear ribonucleoprotein component
15	9606.ENSP00000412566	0.989	Small nuclear ribonucleoprotein-associated proteins B and B
16	9606.ENSP00000460348	0.989	Pre-mRNA-processing-splicing factor 8
17	9606.ENSP00000254193	0.987	U2 small nuclear ribonucleoprotein A
18	9606.ENSP00000301740	0.986	Serine/arginine repetitive matrix protein 2
19	9606.ENSP00000317123	0.986	U5 small nuclear ribonucleoprotein 200 kDa helicase
20	9606.ENSP00000379475	0.985	Spliceosome RNA helicase DDX39B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.615	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0010467	0.995	gene expression
GO:0010629	0.994	negative regulation of gene expression
GO:0008380	0.994	RNA splicing
GO:1901361	0.993	organic cyclic compound catabolic process
GO:0046700	0.993	heterocycle catabolic process
GO:0044270	0.993	cellular nitrogen compound catabolic process
GO:0044260	0.990	cellular macromolecule metabolic process
GO:0006397	0.985	mRNA processing
GO:0000375	0.978	RNA splicing, via transesterification reactions
GO:0000398	0.973	mRNA splicing, via spliceosome
GO:0006402	0.958	mRNA catabolic process
GO:0000956	0.944	nuclear-transcribed mRNA catabolic process
GO:0000184	0.799	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0050794	0.570	regulation of cellular process
GO:0080090	0.370	regulation of primary metabolic process
GO:0051171	0.370	regulation of nitrogen compound metabolic process
GO:0031323	0.369	regulation of cellular metabolic process
GO:0019219	0.310	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0035145	0.984	exon-exon junction complex
GO:1990904	0.970	ribonucleoprotein complex
GO:0005681	0.956	spliceosomal complex
GO:0005684	0.954	U2-type spliceosomal complex
GO:0071011	0.949	precatalytic spliceosome
GO:1902494	0.933	catalytic complex
GO:0071013	0.906	catalytic step 2 spliceosome
GO:0071005	0.880	U2-type precatalytic spliceosome
GO:0005737	0.814	cytoplasm
GO:0005829	0.595	cytosol
GO:0016607	0.485	nuclear speck
GO:0071006	0.325	U2-type catalytic step 1 spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]