StarFunc result for job id Q96A98

User Input

>input (100 residues)
METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPR
RSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96A98	1.000	1.000	1.917E-16	100	1.000	1.000	Q96A98.pdb.gz	TIP39_HUMAN Tuberoinfundibular peptide of 39 residues OS=Homo sapiens OX=9606 GN=PTH2 PE=1 SV=1
2	AFDB:Q91W27	0.666	0.666	1.676E-10	100	0.790	0.790	Q91W27.pdb.gz	TIP39_MOUSE Tuberoinfundibular peptide of 39 residues OS=Mus musculus OX=10090 GN=Pth2 PE=1 SV=1
3	AFDB:Q57Z10	0.343	0.262	2.343	135	0.200	0.148	Q57Z10.pdb.gz	Q57Z10_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.740 PE=4 SV=1
4	AFDB:Q9VWA1	0.379	0.179	2.750	219	0.120	0.055	Q9VWA1.pdb.gz	CLC_DROME Clathrin light chain OS=Drosophila melanogaster OX=7227 GN=Clc PE=1 SV=1
5	AFDB:O43909	0.274	0.041	3.227	919	0.220	0.024	O43909.pdb.gz	EXTL3_HUMAN Exostosin-like 3 OS=Homo sapiens OX=9606 GN=EXTL3 PE=1 SV=1
6	AFDB:P59041	0.243	0.132	4.102	219	0.180	0.082	P59041.pdb.gz	DJC30_MOUSE DnaJ homolog subfamily C member 30, mitochondrial OS=Mus musculus OX=10090 GN=Dnajc30 PE=1 SV=1
7	AFDB:O96113	0.347	0.095	5.649	375	0.130	0.035	O96113.pdb.gz	O96113_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0200600 PE=4 SV=3
8	AFDB:A7SXY9	0.295	0.087	6.119	367	0.190	0.052	A7SXY9.pdb.gz	A7SXY9_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g248021 PE=1 SV=1
9	AFDB:P49957	0.302	0.112	6.629	279	0.110	0.039	P49957.pdb.gz	TRM9_YEAST tRNA (carboxymethyluridine(34)-5-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRM9 PE=1 SV=1
10	AFDB:Q9FKQ6	0.399	0.140	6.629	296	0.140	0.047	Q9FKQ6.pdb.gz	BH099_ARATH Transcription factor bHLH99 OS=Arabidopsis thaliana OX=3702 GN=BHLH99 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96A98	2.91e-63	188	100	1.000	1.000	TIP39_HUMAN Tuberoinfundibular peptide of 39 residues OS=Homo sapiens OX=9606 GN=PTH2 PE=1 SV=1
2	Q91W27	3.35e-39	127	100	0.790	0.790	TIP39_MOUSE Tuberoinfundibular peptide of 39 residues OS=Mus musculus OX=10090 GN=Pth2 PE=1 SV=1
3	Q8QGA2	3.72e-12	60.5	157	0.240	0.153	TIP39_DANRE Tuberoinfundibular peptide of 39 residues OS=Danio rerio OX=7955 GN=pth2 PE=2 SV=1
4	Q8N865	0.89	30.4	590	0.160	0.027	SMIP4_HUMAN Sperm-associated microtubule inner protein 4 OS=Homo sapiens OX=9606 GN=SPMIP4 PE=1 SV=3
5	O16867	1.8	29.6	398	0.260	0.065	TAP_DROME Basic helix-loop-helix neural transcription factor TAP OS=Drosophila melanogaster OX=7227 GN=tap PE=1 SV=2
6	Q7Z4T9	3.4	28.9	767	0.200	0.026	CFA91_HUMAN Cilia- and flagella-associated protein 91 OS=Homo sapiens OX=9606 GN=CFAP91 PE=1 SV=3
7	P01042	6.6	28.1	644	0.130	0.020	KNG1_HUMAN Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14980 TIP39	1.2e-27	106.8	TIP39 peptide

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000270631

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000272847	0.996	Parathyroid hormone 2 receptor
2	9606.ENSP00000282091	0.959	Parathyroid hormone
3	9606.ENSP00000321999	0.933	Parathyroid hormone/parathyroid hormone-related peptide receptor
4	9606.ENSP00000276571	0.738	Corticoliberin
5	9606.ENSP00000441765	0.719	Parathyroid hormone-related protein
6	9606.ENSP00000381105	0.705	Neuropeptide S
7	9606.ENSP00000296099	0.699	Urocortin
8	9606.ENSP00000362716	0.669	Somatoliberin
9	9606.ENSP00000331746	0.657	Calcitonin
10	9606.ENSP00000240652	0.653	Islet amyloid polypeptide
11	9606.ENSP00000433490	0.647	Calcitonin gene-related peptide 2
12	9606.ENSP00000384092	0.628	Pro-opiomelanocortin
13	9606.ENSP00000462647	0.619	Pituitary adenylate cyclase-activating polypeptide
14	9606.ENSP00000379087	0.612	ADM2
15	9606.ENSP00000436607	0.606	ADM
16	9606.ENSP00000176195	0.603	Secretin
17	9606.ENSP00000387662	0.574	Glucagon
18	9606.ENSP00000350005	0.572	Gastric inhibitory polypeptide
19	9606.ENSP00000356213	0.572	VIP peptides
20	9606.ENSP00000369017	0.565	Insulin-like 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0098772	0.440	molecular function regulator activity
GO:0030545	0.300	signaling receptor regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0008152	0.965	metabolic process
GO:0071704	0.940	organic substance metabolic process
GO:0044237	0.939	cellular metabolic process
GO:0044238	0.938	primary metabolic process
GO:0006807	0.929	nitrogen compound metabolic process
GO:1901360	0.925	organic cyclic compound metabolic process
GO:1901564	0.892	organonitrogen compound metabolic process
GO:0072521	0.868	purine-containing compound metabolic process
GO:0009259	0.867	ribonucleotide metabolic process
GO:0009187	0.852	cyclic nucleotide metabolic process
GO:0009150	0.845	purine ribonucleotide metabolic process
GO:1901576	0.842	organic substance biosynthetic process
GO:0019438	0.841	aromatic compound biosynthetic process
GO:0018130	0.841	heterocycle biosynthetic process
GO:0034654	0.833	nucleobase-containing compound biosynthetic process
GO:0050794	0.807	regulation of cellular process
GO:0046390	0.805	ribose phosphate biosynthetic process
GO:0009165	0.802	nucleotide biosynthetic process
GO:0050896	0.766	response to stimulus
GO:0052652	0.720	cyclic purine nucleotide metabolic process
GO:0046058	0.679	cAMP metabolic process
GO:0007165	0.671	signal transduction
GO:0007186	0.645	G protein-coupled receptor signaling pathway
GO:0009190	0.358	cyclic nucleotide biosynthetic process
GO:0009152	0.355	purine ribonucleotide biosynthetic process
GO:0007189	0.310	adenylate cyclase-activating G protein-coupled receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]