StarFunc result for job id Q96AC1

User Input

>input (680 residues)
MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSD
HALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYS
SPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQ
ALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKW
AILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGG
KTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQ
MNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTM
ADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARIL
EAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDAST
GDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRA
KDQNESLDEEMFYKLTSGWV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1Q8X5	0.932	0.926	0.000	684	0.910	0.905	F1Q8X5.pdb.gz	FERM2_DANRE Fermitin family homolog 2 OS=Danio rerio OX=7955 GN=fermt2 PE=2 SV=1
2	AFDB:H0YJ34	0.753	0.794	2.952E-95	640	0.903	0.959	H0YJ34.pdb.gz	H0YJ34_HUMAN FERM domain containing kindlin 2 (Fragment) OS=Homo sapiens OX=9606 GN=FERMT2 PE=1 SV=1
3	AFDB:Q9BQL6	0.867	0.870	2.608E-86	677	0.625	0.628	Q9BQL6.pdb.gz	FERM1_HUMAN Fermitin family homolog 1 OS=Homo sapiens OX=9606 GN=FERMT1 PE=1 SV=1
4	AFDB:P59113	0.704	0.706	1.155E-84	677	0.624	0.626	P59113.pdb.gz	FERM1_MOUSE Fermitin family homolog 1 OS=Mus musculus OX=10090 GN=Fermt1 PE=1 SV=4
5	AFDB:Q86UX7	0.849	0.864	5.425E-78	667	0.532	0.543	Q86UX7.pdb.gz	URP2_HUMAN Fermitin family homolog 3 OS=Homo sapiens OX=9606 GN=FERMT3 PE=1 SV=1
6	AFDB:Q9VZI3	0.825	0.794	1.547E-71	708	0.482	0.463	Q9VZI3.pdb.gz	UN112_DROME Unc-112-related protein OS=Drosophila melanogaster OX=7227 GN=Fit1 PE=1 SV=1
7	AFDB:Q9VVD2	0.827	0.787	1.257E-70	715	0.460	0.438	Q9VVD2.pdb.gz	Q9VVD2_DROME Fermitin 2 OS=Drosophila melanogaster OX=7227 GN=Fit2 PE=2 SV=1
8	AFDB:Q18685	0.775	0.734	9.962E-67	720	0.434	0.410	Q18685.pdb.gz	UN112_CAEEL Protein unc-112 OS=Caenorhabditis elegans OX=6239 GN=unc-112 PE=1 SV=1
9	PDB:7c3mA	0.585	0.687	3.770E-61	577	0.478	0.563	7c3mA.pdb.gz
10	AFDB:G5EGK1	0.470	0.135	2.735E-19	2553	0.144	0.038	G5EGK1.pdb.gz	G5EGK1_CAEEL FERM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tln-1 PE=1 SV=1
11	AFDB:A0A3G2LGI8	0.448	0.132	8.613E-19	2531	0.166	0.045	A0A3G2LGI8.pdb.gz	TLN_OSCPE Talin OS=Oscarella pearsei OX=1940113 GN=TLN PE=1 SV=1
12	PDB:4rm8A	0.349	0.621	7.551E-6	368	0.087	0.160	4rm8A.pdb.gz
13	PDB:3ljuX	0.175	0.275	9.690E-6	373	0.035	0.064	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
14	PDB:6r9tA	0.156	0.058	1.243E-5	2185	0.065	0.020	6r9tA.pdb.gz
15	PDB:6yvaC	0.102	0.418	2.378E-5	155	0.028	0.123	6yvaC.pdb.gz
16	PDB:7rbsB	0.104	0.419	9.611E-5	157	0.018	0.076	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
17	PDB:6u3eA	0.133	0.218	2.244E-4	397	0.050	0.086	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
18	PDB:7nkyQ	0.150	0.221	3.695E-4	404	0.047	0.079	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
19	PDB:7nkyO	0.140	0.195	1.053E-3	427	0.049	0.077	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
20	PDB:6bbpA	0.126	0.162	1.164E-3	520	0.047	0.062	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0U1RRM8	0.0	1060	545	0.762	0.950	A0A0U1RRM8_HUMAN FERM domain containing kindlin 2 (Fragment) OS=Homo sapiens OX=9606 GN=FERMT2 PE=1 SV=1
2	F1Q8X5	0.0	1258	684	0.912	0.906	FERM2_DANRE Fermitin family homolog 2 OS=Danio rerio OX=7955 GN=fermt2 PE=2 SV=1
3	H0YJ34	0.0	1279	640	0.915	0.972	H0YJ34_HUMAN FERM domain containing kindlin 2 (Fragment) OS=Homo sapiens OX=9606 GN=FERMT2 PE=1 SV=1
4	P59113	0.0	880	677	0.632	0.635	FERM1_MOUSE Fermitin family homolog 1 OS=Mus musculus OX=10090 GN=Fermt1 PE=1 SV=4
5	Q18685	0.0	581	720	0.451	0.426	UN112_CAEEL Protein unc-112 OS=Caenorhabditis elegans OX=6239 GN=unc-112 PE=1 SV=1
6	Q86UX7	0.0	712	667	0.531	0.541	URP2_HUMAN Fermitin family homolog 3 OS=Homo sapiens OX=9606 GN=FERMT3 PE=1 SV=1
7	Q8CIB5	0.0	1397	680	0.982	0.982	FERM2_MOUSE Fermitin family homolog 2 OS=Mus musculus OX=10090 GN=Fermt2 PE=1 SV=1
8	Q8K1B8	0.0	744	665	0.537	0.549	URP2_MOUSE Fermitin family homolog 3 OS=Mus musculus OX=10090 GN=Fermt3 PE=1 SV=1
9	Q96AC1	0.0	1417	680	1.000	1.000	FERM2_HUMAN Fermitin family homolog 2 OS=Homo sapiens OX=9606 GN=FERMT2 PE=1 SV=1
10	Q9BQL6	0.0	891	677	0.631	0.634	FERM1_HUMAN Fermitin family homolog 1 OS=Homo sapiens OX=9606 GN=FERMT1 PE=1 SV=1
11	Q9VVD2	0.0	620	715	0.474	0.450	Q9VVD2_DROME Fermitin 2 OS=Drosophila melanogaster OX=7227 GN=Fit2 PE=2 SV=1
12	Q9VZI3	0.0	633	708	0.499	0.479	UN112_DROME Unc-112-related protein OS=Drosophila melanogaster OX=7227 GN=Fit1 PE=1 SV=1
13	G3V3J0	9.95e-106	319	155	0.228	1.000	G3V3J0_HUMAN FERM domain containing kindlin 2 (Fragment) OS=Homo sapiens OX=9606 GN=FERMT2 PE=1 SV=1
14	A0A8I6ABG6	7.56e-12	71.6	2558	0.062	0.016	A0A8I6ABG6_RAT Talin 1 OS=Rattus norvegicus OX=10116 GN=Tln1 PE=1 SV=1
15	G3V852	7.75e-12	71.6	2541	0.062	0.017	G3V852_RAT Talin 1 OS=Rattus norvegicus OX=10116 GN=Tln1 PE=1 SV=1
16	Q9Y490	7.95e-12	71.6	2541	0.062	0.017	TLN1_HUMAN Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3
17	P26039	8.37e-12	71.2	2541	0.062	0.017	TLN1_MOUSE Talin-1 OS=Mus musculus OX=10090 GN=Tln1 PE=1 SV=2
18	P54939	4.04e-10	65.9	2541	0.056	0.015	TLN1_CHICK Talin-1 OS=Gallus gallus OX=9031 GN=TLN1 PE=1 SV=2
19	Q9Y4G6	9.17e-09	61.6	2542	0.051	0.014	TLN2_HUMAN Talin-2 OS=Homo sapiens OX=9606 GN=TLN2 PE=1 SV=4
20	Q5U7N6	9.33e-09	61.6	2538	0.051	0.014	Q5U7N6_DANRE Talin-1 OS=Danio rerio OX=7955 GN=sb:cb854 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00373 FERM_M	5.5e-43	157.4	FERM central domain
2	PF18124 Kindlin_2_N	6.6e-35	130.5	Kindlin-2 N-terminal domain
3	PF00169 PH	3.1e-06	39.0	PH domain
4	PF00788 RA	5.3e+02	12.7	Ras association (RalGDS/AF-6) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9913.ENSBTAP00000019278

Rank	PPI partner	STRING score	Description
1	9913.ENSBTAP00000000927	0.950	Receptor-proximal protein kinase regulating integrin-mediated signal transduction. May act as a mediator of inside-out integrin signaling. Focal adhesion protein part of the complex ILK-PINCH. This complex is considered to be one of the convergence points of integrin- and growth factor-signaling pathway. Could be implicated in mediating cell architecture, adhesion to integrin substrates and anchorage-dependent growth in epithelial cells. Phosphorylates beta-1 and beta-3 integrin subunit on serine and threonine residues, but also AKT1 and GSK3B
2	9913.ENSBTAP00000052015	0.886	Integrin beta-1
3	9913.ENSBTAP00000024101	0.877	Cytoskeletal protein involved in actin-membrane attachment at sites of cell adhesion to the extracellular matrix (focal adhesion).
4	9913.ENSBTAP00000013173	0.778	Bos taurus integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61) (ITGB3), mRNA
5	9913.ENSBTAP00000002170	0.751	Uncharacterized protein
6	9913.ENSBTAP00000021838	0.733	Catenin beta-1
7	9913.ENSBTAP00000004833	0.700	Bos taurus integrin, beta 8 (ITGB8), mRNA
8	9913.ENSBTAP00000053644	0.695	Vinculin
9	9913.ENSBTAP00000001417	0.692	Bos taurus zinc finger, CW type with PWWP domain 1 (ZCWPW1), mRNA
10	9913.ENSBTAP00000019348	0.688	Cas scaffolding protein family member 4
11	9913.ENSBTAP00000024926	0.686	Filamin-binding LIM protein 1
12	9913.ENSBTAP00000000935	0.655	Uncharacterized protein
13	9913.ENSBTAP00000023522	0.652	Junction plakoglobin
14	9913.ENSBTAP00000029307	0.642	Bos taurus parvin, beta (PARVB), mRNA
15	9913.ENSBTAP00000003094	0.641	Transforming growth factor beta-1-induced transcript 1 protein
16	9913.ENSBTAP00000031525	0.634	Bos taurus cyclin-dependent kinase-like 2 (CDC2-related kinase) (CDKL2), mRNA
17	9913.ENSBTAP00000008216	0.632	LIM and senescent cell antigen-like-containing domain protein 2
18	9913.ENSBTAP00000014566	0.632	LIM and senescent cell antigen-like-containing domain protein
19	9913.ENSBTAP00000015471	0.632	SOS Ras/Rac guanine nucleotide exchange factor 1
20	9913.ENSBTAP00000032863	0.632	DNA (cytosine-5-)-methyltransferase 3 alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	0.999	actin binding
GO:0044877	0.991	protein-containing complex binding
GO:0008289	0.877	lipid binding
GO:0051015	0.309	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0048518	0.976	positive regulation of biological process
GO:0050794	0.970	regulation of cellular process
GO:0031589	0.969	cell-substrate adhesion
GO:0045216	0.959	cell-cell junction organization
GO:0022607	0.959	cellular component assembly
GO:0034332	0.952	adherens junction organization
GO:0032501	0.931	multicellular organismal process
GO:0007160	0.919	cell-matrix adhesion
GO:0043954	0.916	cellular component maintenance
GO:0050793	0.889	regulation of developmental process
GO:0007044	0.882	cell-substrate junction assembly
GO:0065003	0.877	protein-containing complex assembly
GO:0045595	0.872	regulation of cell differentiation
GO:0034331	0.872	cell junction maintenance
GO:0043114	0.864	regulation of vascular permeability
GO:0048519	0.859	negative regulation of biological process
GO:0048523	0.852	negative regulation of cellular process
GO:0001952	0.828	regulation of cell-matrix adhesion
GO:0007275	0.809	multicellular organism development
GO:0050896	0.773	response to stimulus
GO:0045785	0.762	positive regulation of cell adhesion
GO:1902903	0.743	regulation of supramolecular fiber organization
GO:0032970	0.729	regulation of actin filament-based process
GO:0051716	0.724	cellular response to stimulus
GO:0150116	0.711	regulation of cell-substrate junction organization
GO:0032956	0.707	regulation of actin cytoskeleton organization
GO:0045217	0.698	cell-cell junction maintenance
GO:0045667	0.687	regulation of osteoblast differentiation
GO:0007165	0.685	signal transduction
GO:0051893	0.675	regulation of focal adhesion assembly
GO:0045669	0.651	positive regulation of osteoblast differentiation
GO:0045599	0.648	negative regulation of fat cell differentiation
GO:0110020	0.646	regulation of actomyosin structure organization
GO:0019222	0.637	regulation of metabolic process
GO:0034446	0.634	substrate adhesion-dependent cell spreading
GO:0009719	0.628	response to endogenous stimulus
GO:0010811	0.617	positive regulation of cell-substrate adhesion
GO:0051130	0.598	positive regulation of cellular component organization
GO:0001954	0.578	positive regulation of cell-matrix adhesion
GO:0098609	0.567	cell-cell adhesion
GO:0071495	0.553	cellular response to endogenous stimulus
GO:0007229	0.540	integrin-mediated signaling pathway
GO:0008104	0.534	protein localization
GO:0032231	0.532	regulation of actin filament bundle assembly
GO:0051240	0.474	positive regulation of multicellular organismal process
GO:0044089	0.438	positive regulation of cellular component biogenesis
GO:0040012	0.429	regulation of locomotion
GO:2000145	0.412	regulation of cell motility
GO:0048583	0.409	regulation of response to stimulus
GO:0023051	0.394	regulation of signaling
GO:0010646	0.394	regulation of cell communication
GO:0072359	0.376	circulatory system development
GO:0009966	0.366	regulation of signal transduction
GO:0048870	0.357	cell motility
GO:0006996	0.340	organelle organization
GO:0048513	0.324	animal organ development
GO:0009888	0.324	tissue development
GO:1903034	0.312	regulation of response to wounding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0030054	0.996	cell junction
GO:0070161	0.994	anchoring junction
GO:0005829	0.990	cytosol
GO:0043231	0.979	intracellular membrane-bounded organelle
GO:0030055	0.959	cell-substrate junction
GO:0005634	0.935	nucleus
GO:0005886	0.925	plasma membrane
GO:0031981	0.911	nuclear lumen
GO:0005925	0.886	focal adhesion
GO:0005654	0.850	nucleoplasm
GO:0043232	0.831	intracellular non-membrane-bounded organelle
GO:0005911	0.667	cell-cell junction
GO:0098552	0.554	side of membrane
GO:0009898	0.475	cytoplasmic side of plasma membrane
GO:0005856	0.356	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]