StarFunc result for job id Q96AD5

User Input

>input (504 residues)
MFPREKTWNISFAGCGFLGVYYVGVASCLREHAPFLVANATHIYGASAGALTATALVTGV
CLGEAGAKFIEVSKEARKRFLGPLHPSFNLVKIIRSFLLKVLPADSHEHASGRLGISLTR
VSDGENVIISHFNSKDELIQANVCSGFIPVYCGLIPPSLQGVRYVDGGISDNLPLYELKN
TITVSPFSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPLVLREMCKQ
GYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQAVESAQAEDYSQLPGEDHILEHL
PARLNEALLEACVEPTDLLTTLSNMLPVRLATAMMVPYTLPLESALSFTIRLLEWLPDVP
EDIRWMKEQTGSICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALP
GWMRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPEALRMRAPADPAPAPADPASPQHQ
LAGPAPLLSTPAPEARPVIGALGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96AD5	1.000	1.000	9.995E-83	504	1.000	1.000	Q96AD5.pdb.gz	PLPL2_HUMAN Patatin-like phospholipase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PNPLA2 PE=1 SV=1
2	AFDB:Q8BJ56	0.818	0.847	4.611E-70	486	0.833	0.864	Q8BJ56.pdb.gz	PLPL2_MOUSE Patatin-like phospholipase domain-containing protein 2 OS=Mus musculus OX=10090 GN=Pnpla2 PE=1 SV=1
3	AFDB:A0A0R4IUV2	0.685	0.729	1.666E-46	473	0.466	0.497	A0A0R4IUV2.pdb.gz
4	AFDB:D3Z9J9	0.666	0.785	2.364E-41	425	0.343	0.407	D3Z9J9.pdb.gz	D3Z9J9_RAT Patatin-like phospholipase domain containing 3 OS=Rattus norvegicus OX=10116 GN=Pnpla3 PE=1 SV=2
5	AFDB:Q9NST1	0.677	0.708	1.130E-39	481	0.383	0.401	Q9NST1.pdb.gz	PLPL3_HUMAN 1-acylglycerol-3-phosphate O-acyltransferase PNPLA3 OS=Homo sapiens OX=9606 GN=PNPLA3 PE=1 SV=2
6	AFDB:Q7Z6Z6	0.655	0.766	4.834E-36	429	0.315	0.371	Q7Z6Z6.pdb.gz	PLPL5_HUMAN Patatin-like phospholipase domain-containing protein 5 OS=Homo sapiens OX=9606 GN=PNPLA5 PE=1 SV=1
7	AFDB:Q8T3F2	0.538	0.365	5.919E-34	751	0.321	0.216	Q8T3F2.pdb.gz	Q8T3F2_CAEEL PNPLA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=atgl-1 PE=1 SV=1
8	AFDB:E1JI03	0.552	0.505	7.272E-33	553	0.319	0.291	E1JI03.pdb.gz	E1JI03_DROME Brummer, isoform B OS=Drosophila melanogaster OX=7227 GN=bmm PE=4 SV=1
9	AFDB:Q8N8W4	0.486	0.461	8.848E-29	532	0.294	0.278	Q8N8W4.pdb.gz	PLPL1_HUMAN Omega-hydroxyceramide transacylase OS=Homo sapiens OX=9606 GN=PNPLA1 PE=1 SV=3
10	AFDB:Q3V1D5	0.477	0.403	2.775E-26	599	0.286	0.240	Q3V1D5.pdb.gz	PLPL1_MOUSE Omega-hydroxyceramide transacylase OS=Mus musculus OX=10090 GN=Pnpla1 PE=1 SV=1
11	PDB:4akfA	0.259	0.235	1.018E-4	560	0.121	0.109	4akfA.pdb.gz
12	PDB:6aunA	0.273	0.227	4.882E-4	618	0.087	0.071	6aunA.pdb.gz
13	PDB:5ixcA	0.173	0.133	6.299E-2	684	0.048	0.035	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:5izrC	0.168	0.134	9.082E-2	659	0.050	0.038	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:1cjyA	0.236	0.195	3.354E-1	633	0.089	0.071	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
16	PDB:5iz5B	0.168	0.120	8.154E-1	746	0.052	0.035	5iz5B.pdb.gz
17	PDB:5iz5A	0.157	0.110	1.239	757	0.048	0.032	5iz5A.pdb.gz
18	PDB:1emsA	0.094	0.110	1.982	412	0.020	0.024	1emsA.pdb.gz
19	PDB:6tedR	0.102	0.187	2.713	244	0.038	0.078	6tedR.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
20	PDB:7x11A	0.118	0.110	3.173	564	0.067	0.060	7x11A.pdb.gz	Discovery and Characterization of a Novel Allosteric Small-Molecule Inhibitor of NADP + -Dependent Malic Enzyme 1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C548	0.0	847	478	0.829	0.874	PLPL2_RAT Patatin-like phospholipase domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Pnpla2 PE=1 SV=1
2	Q8BJ56	0.0	850	486	0.835	0.866	PLPL2_MOUSE Patatin-like phospholipase domain-containing protein 2 OS=Mus musculus OX=10090 GN=Pnpla2 PE=1 SV=1
3	Q96AD5	0.0	1026	504	1.000	1.000	PLPL2_HUMAN Patatin-like phospholipase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PNPLA2 PE=1 SV=1
4	Q6DHN9	7.21e-152	444	473	0.438	0.467	Q6DHN9_DANRE Patatin-like phospholipase domain-containing protein 2 OS=Danio rerio OX=7955 GN=zgc:92195 PE=2 SV=1
5	Q9NST1	2.21e-115	350	481	0.361	0.378	PLPL3_HUMAN 1-acylglycerol-3-phosphate O-acyltransferase PNPLA3 OS=Homo sapiens OX=9606 GN=PNPLA3 PE=1 SV=2
6	Q91WW7	3.10e-111	337	413	0.339	0.414	PLPL3_MOUSE 1-acylglycerol-3-phosphate O-acyltransferase Pnpla3 OS=Mus musculus OX=10090 GN=Pnpla3 PE=1 SV=1
7	D3Z9J9	3.66e-111	338	425	0.333	0.395	D3Z9J9_RAT Patatin-like phospholipase domain containing 3 OS=Rattus norvegicus OX=10116 GN=Pnpla3 PE=1 SV=2
8	Q7Z6Z6	2.13e-85	271	429	0.302	0.354	PLPL5_HUMAN Patatin-like phospholipase domain-containing protein 5 OS=Homo sapiens OX=9606 GN=PNPLA5 PE=1 SV=1
9	Q9VUH7	1.84e-80	261	507	0.254	0.252	Q9VUH7_DROME Brummer, isoform A OS=Drosophila melanogaster OX=7227 GN=bmm PE=2 SV=1
10	E1JI03	4.11e-80	261	553	0.254	0.231	E1JI03_DROME Brummer, isoform B OS=Drosophila melanogaster OX=7227 GN=bmm PE=4 SV=1
11	Q11186	6.28e-79	260	621	0.308	0.250	PLPL2_CAEEL Patanin-like phospholipase domain-containing protein atgl-1 OS=Caenorhabditis elegans OX=6239 GN=atgl-1 PE=1 SV=2
12	Q8T3F2	7.43e-77	258	751	0.312	0.209	Q8T3F2_CAEEL PNPLA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=atgl-1 PE=1 SV=1
13	Q8N8W4	1.88e-69	233	532	0.218	0.207	PLPL1_HUMAN Omega-hydroxyceramide transacylase OS=Homo sapiens OX=9606 GN=PNPLA1 PE=1 SV=3
14	Q3V1D5	1.18e-68	233	599	0.228	0.192	PLPL1_MOUSE Omega-hydroxyceramide transacylase OS=Mus musculus OX=10090 GN=Pnpla1 PE=1 SV=1
15	P41247	1.16e-50	175	253	0.181	0.360	PLPL4_HUMAN Patatin-like phospholipase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=PNPLA4 PE=1 SV=3
16	Q386C0	5.70e-05	47.4	321	0.073	0.115	Q386C0_TRYB2 PNPLA domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1440 PE=4 SV=1
17	Q5ZRP9	5.86e-04	45.1	621	0.046	0.037	Q5ZRP9_LEGPH VipD OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=vipD PE=1 SV=1
18	O95398	0.15	37.4	923	0.093	0.051	RPGF3_HUMAN Rap guanine nucleotide exchange factor 3 OS=Homo sapiens OX=9606 GN=RAPGEF3 PE=1 SV=6
19	O23522	0.82	34.7	517	0.032	0.031	PLA14_ARATH Phospholipase A1-Ibeta2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At4g16820 PE=1 SV=2
20	Q558U1	5.0	32.3	2258	0.040	0.009	IFKA_DICDI Probable serine/threonine-protein kinase ifkA OS=Dictyostelium discoideum OX=44689 GN=ifkA PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01734 Patatin	6.6e-12	57.6	Patatin-like phospholipase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337701

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000390849	0.999	1-acylglycerol-3-phosphate O-acyltransferase ABHD5
2	9606.ENSP00000244289	0.995	Hormone-sensitive lipase
3	9606.ENSP00000371272	0.993	Perilipin-5
4	9606.ENSP00000265052	0.983	Monoglyceride lipase
5	9606.ENSP00000309757	0.970	Lipoprotein lipase
6	9606.ENSP00000300055	0.967	Perilipin-1
7	9606.ENSP00000276914	0.963	Perilipin-2
8	9606.ENSP00000355996	0.951	G0/G1 switch protein 2
9	9606.ENSP00000482264	0.936	Diacylglycerol O-acyltransferase 1
10	9606.ENSP00000299022	0.925	Hepatic triacylglycerol lipase
11	9606.ENSP00000261942	0.920	FAS-associated factor 2
12	9606.ENSP00000228027	0.919	Diacylglycerol O-acyltransferase 2
13	9606.ENSP00000358232	0.903	Pancreatic lipase related protein 3
14	9606.ENSP00000358223	0.902	Pancreatic lipase
15	9606.ENSP00000347581	0.900	Acylglycerol kinase, mitochondrial
16	9606.ENSP00000373328	0.877	Cell death activator CIDE-3
17	9606.ENSP00000261292	0.861	Endothelial lipase
18	9606.ENSP00000254722	0.860	Pigment epithelium-derived factor
19	9606.ENSP00000433933	0.857	Inactive pancreatic lipase-related protein 1
20	9606.ENSP00000361151	0.851	Bile salt-activated lipase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004806	1.000	triglyceride lipase activity
GO:0016746	0.995	acyltransferase activity
GO:0016747	0.993	acyltransferase activity, transferring groups other than amino-acyl groups
GO:0008374	0.983	O-acyltransferase activity
GO:0004620	0.972	phospholipase activity
GO:0016411	0.958	acylglycerol O-acyltransferase activity
GO:0004623	0.873	phospholipase A2 activity
GO:0004465	0.797	lipoprotein lipase activity
GO:0051265	0.498	diolein transacylation activity
GO:0051264	0.498	mono-olein transacylation activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0065007	0.995	biological regulation
GO:0034389	0.994	lipid droplet organization
GO:0006629	0.992	lipid metabolic process
GO:0010883	0.989	regulation of lipid storage
GO:0048518	0.988	positive regulation of biological process
GO:1905952	0.987	regulation of lipid localization
GO:0090207	0.987	regulation of triglyceride metabolic process
GO:0045834	0.976	positive regulation of lipid metabolic process
GO:0006638	0.967	neutral lipid metabolic process
GO:0006639	0.964	acylglycerol metabolic process
GO:1905953	0.933	negative regulation of lipid localization
GO:0050994	0.932	regulation of lipid catabolic process
GO:0048522	0.928	positive regulation of cellular process
GO:0090208	0.922	positive regulation of triglyceride metabolic process
GO:0050996	0.916	positive regulation of lipid catabolic process
GO:0031331	0.660	positive regulation of cellular catabolic process
GO:0009058	0.489	biosynthetic process
GO:0044249	0.468	cellular biosynthetic process
GO:1901576	0.456	organic substance biosynthetic process
GO:0008610	0.361	lipid biosynthetic process
GO:0006796	0.334	phosphate-containing compound metabolic process
GO:0006641	0.329	triglyceride metabolic process
GO:0051179	0.312	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005811	1.000	lipid droplet
GO:0012505	0.996	endomembrane system
GO:0031974	0.995	membrane-enclosed lumen
GO:0070013	0.987	intracellular organelle lumen
GO:0043231	0.973	intracellular membrane-bounded organelle
GO:0005829	0.969	cytosol
GO:0016020	0.949	membrane
GO:0031090	0.916	organelle membrane
GO:0071944	0.915	cell periphery
GO:0031981	0.913	nuclear lumen
GO:0031984	0.898	organelle subcompartment
GO:0005654	0.877	nucleoplasm
GO:0098827	0.868	endoplasmic reticulum subcompartment
GO:0005789	0.853	endoplasmic reticulum membrane
GO:0005886	0.799	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12044	1.000	a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+)
EC:3.1.1.3	1.000	triacylglycerol lipase.
EC:2.3.-.-	0.995	Acyltransferases.
EC:2.3.1.-	0.993	Transferring groups other than amino-acyl groups.
RHEA:15801	0.873	a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+)
EC:3.1.1.4	0.873	phospholipase A2.
EC:3.1.1.34	0.797	lipoprotein lipase.

[back to server]