StarFunc result for job id Q96AE7

User Input

>input (1141 residues)
MAAAVGVRGRYELPPCSGPGWLLSLSALLSVAARGAFATTHWVVTEDGKIQQQVDSPMNL
KHPHDLVILMRQEATVNYLKELEKQLVAQKIHIEENEDRDTGLEQRHNKEDPDCIKAKVP
LGDLDLYDGTYITLESKDISPEDYIDTESPVPPDPEQPDCTKILELPYSIHAFQHLRGVQ
ERVNLSAPLLPKEDPIFTYLSKRLGRSIDDIGHLIHEGLQKNTSSWVLYNMASFYWRIKN
EPYQVVECAMRALHFSSRHNKDIALVNLANVLHRAHFSADAAVVVHAALDDSDFFTSYYT
LGNIYAMLGEYNHSVLCYDHALQARPGFEQAIKRKHAVLCQQKLEQKLEAQHRSLQRTLN
ELKEYQKQHDHYLRQQEILEKHKLIQEEQILRNIIHETQMAKEAQLGNHQICRLVNQQHS
LHCQWDQPVRYHRGDIFENVDYVQFGEDSSTSSMMSVNFDVQSNQSDINDSVKSSPVAHS
ILWIWGRDSDAYRDKQHILWPKRADCTESYPRVPVGGELPTYFLPPENKGLRIHELSSDD
YSTEEEAQTPDCSITDFRKSHTLSYLVKELEVRMDLKAKMPDDHARKILLSRINNYTIPE
EEIGSFLFHAINKPNAPIWLILNEAGLYWRAVGNSTFAIACLQRALNLAPLQYQDVPLVN
LANLLIHYGLHLDATKLLLQALAINSSEPLTFLSLGNAYLALKNISGALEAFRQALKLTT
KCPECENSLKLIRCMQFYPFLYNITSSVCSGTVVEESNGSDEMENSDETKMSEEILALVD
EFQQAWPLEGFGGALEMKGRRLDLQGIRVLKKGPQDGVARSSCYGDCRSEDDEATEWITF
QVKRVKKPKGDHKKTPGKKVETGQIENGHRYQANLEITGPKVASPGPQGKKRDYQRLGWP
SPDECLKLRWVELTAIVSTWLAVSSKNIDITEHIDFATPIQQPAMEPLCNGNLPTSMHTL
DHLHGVSNRASLHYTGESQLTEVLQNLGKDQYPQQSLEQIGTRIAKVLEKNQTSWVLSSM
AALYWRVKGQGKKAIDCLRQALHYAPHQMKDVPLISLANILHNAKLWNDAVIVATMAVEI
APHFAVNHFTLGNVYVAMEEFEKALVWYESTLKLQPEFVPAKNRIQTIQCHLMLKKGRRS
P

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5DEL3	0.489	0.470	0.000	1198	0.954	0.908	B5DEL3.pdb.gz	TTC17_RAT Tetratricopeptide repeat protein 17 OS=Rattus norvegicus OX=10116 GN=Ttc17 PE=1 SV=1
2	AFDB:Q96AE7	1.000	1.000	0.000	1141	1.000	1.000	Q96AE7.pdb.gz	TTC17_HUMAN Tetratricopeptide repeat protein 17 OS=Homo sapiens OX=9606 GN=TTC17 PE=1 SV=1
3	AFDB:E7F211	0.556	0.532	8.557E-92	1198	0.613	0.584	E7F211.pdb.gz	TTC17_DANRE Tetratricopeptide repeat protein 17 OS=Danio rerio OX=7955 GN=ttc17 PE=3 SV=1
4	AFDB:Q07617	0.111	0.128	2.673E-6	926	0.096	0.118	Q07617.pdb.gz	SPAG1_HUMAN Sperm-associated antigen 1 OS=Homo sapiens OX=9606 GN=SPAG1 PE=1 SV=3
5	AFDB:O60184	0.120	0.124	2.368E-5	1102	0.096	0.099	O60184.pdb.gz	CYC8_SCHPO General transcriptional corepressor ssn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssn6 PE=1 SV=1
6	PDB:7dhgC	0.121	0.277	6.579E-5	470	0.068	0.166	7dhgC.pdb.gz
7	PDB:6tedQ	0.118	0.147	7.710E-5	890	0.105	0.135	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
8	PDB:4bujB	0.120	0.104	1.146E-4	1367	0.102	0.085	4bujB.pdb.gz
9	PDB:7qdrB	0.139	0.134	1.919E-4	1212	0.107	0.101	7qdrB.pdb.gz
10	PDB:4kvmB	0.102	0.149	3.089E-4	722	0.066	0.104	4kvmB.pdb.gz	Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
11	PDB:7qe7K	0.114	0.239	6.563E-4	531	0.071	0.153	7qe7K.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
12	PDB:7qe7Y	0.113	0.240	1.288E-3	502	0.076	0.173	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
13	PDB:7dkhI	0.167	0.195	1.394E-3	914	0.090	0.113	7dkhI.pdb.gz
14	PDB:7ntfA	0.123	0.151	1.840E-3	918	0.067	0.083	7ntfA.pdb.gz
15	PDB:4xnhA	0.131	0.176	2.630E-3	786	0.058	0.084	4xnhA.pdb.gz	Crystal structure of yeast N-terminal acetyltransferase NatE (IP6) in complex with a bisubstrate
16	AFDB:A0A0G2K6D0	0.112	0.094	6.102E-3	1366	0.076	0.064	A0A0G2K6D0.pdb.gz	A0A0G2K6D0_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=2
17	AFDB:Q9N593	0.107	0.148	9.440E-3	788	0.074	0.108	Q9N593.pdb.gz	CDC27_CAEEL Cell division cycle protein 27 homolog OS=Caenorhabditis elegans OX=6239 GN=mat-1 PE=1 SV=1
18	AFDB:Q585V5	0.107	0.239	9.822E-3	489	0.056	0.131	Q585V5.pdb.gz	Q585V5_TRYB2 TPR-repeat protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.25 PE=4 SV=1
19	AFDB:O88196	0.105	0.071	1.063E-2	1979	0.077	0.044	O88196.pdb.gz	TTC3_MOUSE E3 ubiquitin-protein ligase TTC3 OS=Mus musculus OX=10090 GN=Ttc3 PE=1 SV=2
20	AFDB:Q9UGR2	0.091	0.105	5.405E-2	977	0.047	0.055	Q9UGR2.pdb.gz	Z3H7B_HUMAN Zinc finger CCCH domain-containing protein 7B OS=Homo sapiens OX=9606 GN=ZC3H7B PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5DEL3	0.0	2212	1198	0.947	0.902	TTC17_RAT Tetratricopeptide repeat protein 17 OS=Rattus norvegicus OX=10116 GN=Ttc17 PE=1 SV=1
2	E7F211	0.0	1399	1198	0.614	0.585	TTC17_DANRE Tetratricopeptide repeat protein 17 OS=Danio rerio OX=7955 GN=ttc17 PE=3 SV=1
3	Q96AE7	0.0	2383	1141	1.000	1.000	TTC17_HUMAN Tetratricopeptide repeat protein 17 OS=Homo sapiens OX=9606 GN=TTC17 PE=1 SV=1
4	Q7KJA9	6.97e-04	46.2	1059	0.026	0.028	Q7KJA9_DROME protein O-GlcNAc transferase OS=Drosophila melanogaster OX=7227 GN=sxc PE=1 SV=1
5	Q9Y148	7.14e-04	46.2	1011	0.026	0.030	Q9Y148_DROME protein O-GlcNAc transferase (Fragment) OS=Drosophila melanogaster OX=7227 GN=sxc PE=2 SV=1
6	Q9M8Y0	0.003	44.3	977	0.026	0.031	SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
7	O15294	0.005	43.5	1046	0.025	0.028	OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
8	P56558	0.005	43.5	1036	0.025	0.028	OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ogt PE=1 SV=1
9	P81436	0.005	43.5	1046	0.025	0.028	OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
10	Q8CGY8	0.005	43.5	1046	0.025	0.028	OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
11	Q2L6Y4	0.015	42.0	973	0.019	0.023	Q2L6Y4_CAEEL protein O-GlcNAc transferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=1
12	O18158	0.017	42.0	1151	0.019	0.019	OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=2
13	Q5GA10	0.018	41.6	1036	0.025	0.027	Q5GA10_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
14	Q5GA11	0.018	42.0	1046	0.025	0.027	Q5GA11_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
15	Q5GA13	0.018	41.6	1062	0.025	0.026	Q5GA13_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
16	Q5GA12	0.019	41.6	1052	0.025	0.027	Q5GA12_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
17	P73762	0.024	40.4	294	0.027	0.105	P73762_SYNY3 Sll0837 protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll0837 PE=4 SV=1
18	A0A0R4IVJ0	0.067	40.0	1102	0.024	0.025	A0A0R4IVJ0_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=ogt.2 PE=1 SV=1
19	O77033	0.067	40.0	1390	0.024	0.019	CYC8_DICDI General transcriptional corepressor trfA OS=Dictyostelium discoideum OX=44689 GN=trfA PE=2 SV=1
20	Q4GYI6	0.070	39.7	907	0.020	0.025	Q4GYI6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3910 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09295 ChAPs	1.8	19.1	ChAPs (Chs5p-Arf1p-binding proteins)
2	PF00515 TPR_1	7.9e-22	87.3	Tetratricopeptide repeat
3	PF13374 TPR_10	0.32	22.2	Tetratricopeptide repeat
4	PF13414 TPR_11	1.1e-10	52.3	TPR repeat
5	PF13424 TPR_12	4e-10	51.2	Tetratricopeptide repeat
6	PF13428 TPR_14	1.1e-05	36.8	Tetratricopeptide repeat
7	PF13432 TPR_16	6.5	18.7	Tetratricopeptide repeat
8	PF13431 TPR_17	8.1e+02	11.9	Tetratricopeptide repeat
9	PF14559 TPR_19	0.077	24.8	Tetratricopeptide repeat
10	PF07719 TPR_2	5.3e-20	80.9	Tetratricopeptide repeat
11	PF13174 TPR_6	2.1e+02	14.0	Tetratricopeptide repeat
12	PF13176 TPR_7	5.6e-07	40.2	Tetratricopeptide repeat
13	PF13181 TPR_8	3.2e-09	47.3	Tetratricopeptide repeat
14	PF13371 TPR_9	0.33	22.4	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000039989

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384160	0.605	RNA-binding protein 33
2	9606.ENSP00000337445	0.545	Zinc phosphodiesterase ELAC protein 2
3	9606.ENSP00000368517	0.535	Enoyl-CoA hydratase domain-containing protein 3, mitochondrial
4	9606.ENSP00000455507	0.532	Obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF
5	9606.ENSP00000319104	0.528	Transcription elongation factor SPT6
6	9606.ENSP00000277575	0.502	USP6 N-terminal-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.538	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0006996	0.977	organelle organization
GO:0065003	0.975	protein-containing complex assembly
GO:0030041	0.965	actin filament polymerization
GO:0044782	0.897	cilium organization
GO:0050789	0.336	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.966	intracellular organelle
GO:0043232	0.950	intracellular non-membrane-bounded organelle
GO:0016020	0.926	membrane
GO:0005829	0.914	cytosol
GO:0071944	0.899	cell periphery
GO:0005886	0.879	plasma membrane
GO:0043227	0.783	membrane-bounded organelle
GO:0043231	0.540	intracellular membrane-bounded organelle
GO:0031981	0.510	nuclear lumen
GO:0005654	0.484	nucleoplasm
GO:0005856	0.434	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]