StarFunc result for job id Q96AG3

User Input

>input (418 residues)
MHPRRPDGFDGLGYRGGARDEQGFGGAFPARSFSTGSDLGHWVTTPPDIPGSRNLHWGEK
SPPYGVPTTSTPYEGPTEEPFSSGGGGSVQGQSSEQLNRFAGFGIGLASLFTENVLAHPC
IVLRRQCQVNYHAQHYHLTPFTVINIMYSFNKTQGPRALWKGMGSTFIVQGVTLGAEGII
SEFTPLPREVLHKWSPKQIGEHLLLKSLTYVVAMPFYSASLIETVQSEIIRDNTGILECV
KEGIGRVIGMGVPHSKRLLPLLSLIFPTVLHGVLHYIISSVIQKFVLLILKRKTYNSHLA
ESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTIIDNTDLGYEVL
PINTQYEGMRDCINTIRQEEGVFGFYKGFGAVIIQYTLHAAVLQITKIIYSTLLQNNI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96AG3	1.000	1.000	8.115E-55	418	1.000	1.000	Q96AG3.pdb.gz	S2546_HUMAN Mitochondrial outer membrane protein SLC25A46 OS=Homo sapiens OX=9606 GN=SLC25A46 PE=1 SV=1
2	AFDB:Q9CQS4	0.838	0.838	2.500E-47	418	0.890	0.890	Q9CQS4.pdb.gz	S2546_MOUSE Mitochondrial outer membrane protein SLC25A46 OS=Mus musculus OX=10090 GN=Slc25a46 PE=1 SV=1
3	AFDB:Q6DGU5	0.781	0.806	3.522E-39	405	0.706	0.728	Q6DGU5.pdb.gz	S2546_DANRE Mitochondrial outer membrane protein SLC25A46 OS=Danio rerio OX=7955 GN=slc25a46 PE=2 SV=1
4	AFDB:Q9VJA5	0.745	0.694	1.285E-23	450	0.280	0.260	Q9VJA5.pdb.gz	Q9VJA5_DROME FI08023p OS=Drosophila melanogaster OX=7227 GN=Slc25A46b PE=2 SV=1
5	AFDB:Q9LV81	0.502	0.492	2.664E-8	428	0.139	0.136	Q9LV81.pdb.gz	BRTL3_ARATH Probable mitochondrial adenine nucleotide transporter BTL3 OS=Arabidopsis thaliana OX=3702 GN=At5g64970 PE=2 SV=1
6	AFDB:P29518	0.427	0.412	3.457E-8	436	0.146	0.140	P29518.pdb.gz	BT1_MAIZE Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays OX=4577 GN=BT1 PE=1 SV=1
7	AFDB:P31167	0.441	0.474	6.632E-8	381	0.124	0.136	P31167.pdb.gz	ADT1_ARATH ADP,ATP carrier protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=AAC1 PE=1 SV=2
8	AFDB:P40556	0.446	0.486	7.891E-8	373	0.136	0.153	P40556.pdb.gz	YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YIA6 PE=1 SV=1
9	AFDB:Q9C9R4	0.459	0.459	1.069E-7	418	0.151	0.151	Q9C9R4.pdb.gz	BRTL2_ARATH Probable mitochondrial adenine nucleotide transporter BTL2 OS=Arabidopsis thaliana OX=3702 GN=At1g78180 PE=2 SV=1
10	AFDB:Q8TFH2	0.468	0.588	1.581E-7	317	0.112	0.148	Q8TFH2.pdb.gz	YIKC_SCHPO Uncharacterized mitochondrial carrier PB17E12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB17E12.12c PE=3 SV=1
11	PDB:4c9qB	0.407	0.548	1.085E-6	290	0.122	0.176	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.386	0.514	2.477E-6	293	0.127	0.181	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.348	0.453	5.405E-3	292	0.127	0.182	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:7p5cA	0.099	0.104	9.500E-2	392	0.112	0.120	7p5cA.pdb.gz
15	PDB:7p54A	0.095	0.098	1.745E-1	397	0.139	0.146	7p54A.pdb.gz
16	PDB:7bp3A	0.151	0.157	9.494E-1	394	0.096	0.102	7bp3A.pdb.gz
17	PDB:5oxpA	0.123	0.115	1.130	462	0.067	0.061	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
18	PDB:7p5jA	0.101	0.104	1.130	399	0.110	0.115	7p5jA.pdb.gz
19	PDB:2nuuD	0.101	0.102	1.744	410	0.100	0.102	2nuuD.pdb.gz	The crystal structure of the Escherichia coli AmtB-GlnK complex reveals how GlnK regulates the ammonia channel
20	PDB:6ob7A	0.126	0.135	1.744	381	0.110	0.121	6ob7A.pdb.gz	Structures of human ENT1 in complex with adenosine reuptake inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6DGU5	0.0	593	405	0.703	0.726	S2546_DANRE Mitochondrial outer membrane protein SLC25A46 OS=Danio rerio OX=7955 GN=slc25a46 PE=2 SV=1
2	Q96AG3	0.0	858	418	1.000	1.000	S2546_HUMAN Mitochondrial outer membrane protein SLC25A46 OS=Homo sapiens OX=9606 GN=SLC25A46 PE=1 SV=1
3	Q9CQS4	0.0	751	418	0.890	0.890	S2546_MOUSE Mitochondrial outer membrane protein SLC25A46 OS=Mus musculus OX=10090 GN=Slc25a46 PE=1 SV=1
4	Q9VJA5	7.42e-75	242	450	0.280	0.260	Q9VJA5_DROME FI08023p OS=Drosophila melanogaster OX=7227 GN=Slc25A46b PE=2 SV=1
5	Q9FM86	5.22e-04	44.3	330	0.117	0.148	ADT5_ARATH Probable ADP,ATP carrier protein At5g56450 OS=Arabidopsis thaliana OX=3702 GN=At5g56450 PE=2 SV=1
6	O04200	5.42e-04	44.3	331	0.074	0.094	PXN_ARATH Peroxisomal nicotinamide adenine dinucleotide carrier OS=Arabidopsis thaliana OX=3702 GN=PXN PE=1 SV=1
7	Q5JPC1	5.55e-04	43.9	320	0.136	0.178	Q5JPC1_HUMAN Solute carrier family 25 (Mitochondrial deoxynucleotide carrier), member 19, isoform CRA_a OS=Homo sapiens OX=9606 GN=DKFZp667O1614 PE=2 SV=1
8	Q9HC21	5.55e-04	43.9	320	0.136	0.178	TPC_HUMAN Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens OX=9606 GN=SLC25A19 PE=1 SV=1
9	P04710	0.002	42.7	309	0.065	0.087	ADT1_YEAST ADP,ATP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AAC1 PE=1 SV=1
10	Q9BQT8	0.002	42.0	299	0.081	0.114	ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens OX=9606 GN=SLC25A21 PE=1 SV=1
11	Q9H0C2	0.002	42.4	315	0.065	0.086	ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens OX=9606 GN=SLC25A31 PE=1 SV=1
12	O22261	0.003	41.6	312	0.062	0.083	NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NDT1 PE=1 SV=2
13	Q8RWA5	0.004	41.6	363	0.057	0.066	NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDT2 PE=1 SV=1
14	Q7K0L7	0.005	41.2	332	0.050	0.063	Q7K0L7_DROME LP01207p OS=Drosophila melanogaster OX=7227 GN=Tpc1 PE=1 SV=1
15	O01813	0.006	40.8	300	0.074	0.103	O01813_CAEEL ADP/ATP translocase OS=Caenorhabditis elegans OX=6239 GN=ant-1.2 PE=1 SV=1
16	P18238	0.006	40.8	307	0.065	0.088	ADT3_YEAST ADP,ATP carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AAC3 PE=1 SV=1
17	P18239	0.006	40.8	318	0.065	0.085	ADT2_YEAST ADP,ATP carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PET9 PE=1 SV=2
18	Q94AG6	0.007	40.8	325	0.057	0.074	SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SAMC1 PE=1 SV=1
19	Q3V132	0.008	40.4	320	0.057	0.075	ADT4_MOUSE ADP/ATP translocase 4 OS=Mus musculus OX=10090 GN=Slc25a31 PE=1 SV=1
20	Q96CQ1	0.008	40.4	311	0.132	0.177	S2536_HUMAN Solute carrier family 25 member 36 OS=Homo sapiens OX=9606 GN=SLC25A36 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00153 Mito_carr	9.4e-15	65.6	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348211

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000420617	0.726	Mitofusin-1
2	9606.ENSP00000401477	0.720	Transmembrane protein 232
3	9606.ENSP00000263997	0.713	Probable RNA polymerase II nuclear localization protein SLC7A6OS
4	9606.ENSP00000262570	0.706	MICOS complex subunit MIC19
5	9606.ENSP00000215882	0.699	Tricarboxylate transport protein, mitochondrial
6	9606.ENSP00000235329	0.691	Mitofusin-2
7	9606.ENSP00000362268	0.682	MICOS complex subunit MIC27
8	9606.ENSP00000354681	0.675	Dynamin-like 120 kDa protein, mitochondrial
9	9606.ENSP00000345445	0.647	Sorting and assembly machinery component 50 homolog
10	9606.ENSP00000368959	0.647	Receptor expression-enhancing protein 5
11	9606.ENSP00000319817	0.622	Optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia)
12	9606.ENSP00000387262	0.614	MICOS complex subunit MIC60
13	9606.ENSP00000416418	0.595	Sodium/hydrogen exchanger 8
14	9606.ENSP00000303222	0.589	Mitochondrial carrier homolog 2
15	9606.ENSP00000273158	0.578	Solute carrier family 25 member 38
16	9606.ENSP00000290913	0.577	MICOS complex subunit MIC25
17	9606.ENSP00000302037	0.571	Mitochondrial fission factor
18	9606.ENSP00000338671	0.554	Rho-related BTB domain-containing protein 1
19	9606.ENSP00000332194	0.551	Histone H2A type 2-C
20	9606.ENSP00000415998	0.545	Heme transporter HRG1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0022857	0.934	transmembrane transporter activity
GO:0008514	0.310	organic anion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0071840	0.977	cellular component organization or biogenesis
GO:0007005	0.955	mitochondrion organization
GO:0051179	0.584	localization
GO:0006810	0.407	transport
GO:0061024	0.386	membrane organization
GO:0007006	0.363	mitochondrial membrane organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005741	0.995	mitochondrial outer membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]