StarFunc result for job id Q96AH0

User Input

>input (204 residues)
MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWD
EIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYR
GQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQ
GTASNQTVMTTISNGRDPRRAFKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96AH0	0.999	0.999	1.673E-33	204	1.000	1.000	Q96AH0.pdb.gz	SOSB2_HUMAN SOSS complex subunit B2 OS=Homo sapiens OX=9606 GN=NABP1 PE=1 SV=1
2	AFDB:Q8BGW5	0.807	0.830	2.336E-28	198	0.814	0.838	Q8BGW5.pdb.gz	SOSB2_MOUSE SOSS complex subunit B2 OS=Mus musculus OX=10090 GN=Nabp1 PE=2 SV=1
3	AFDB:Q8R2Y9	0.639	0.617	4.225E-22	212	0.569	0.547	Q8R2Y9.pdb.gz	SOSB1_MOUSE SOSS complex subunit B1 OS=Mus musculus OX=10090 GN=Nabp2 PE=1 SV=1
4	PDB:4owwB	0.521	0.988	4.665E-18	107	0.451	0.860	4owwB.pdb.gz	Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
5	AFDB:O49453	0.482	0.634	7.563E-8	153	0.123	0.163	O49453.pdb.gz	Y4844_ARATH Uncharacterized protein At4g28440 OS=Arabidopsis thaliana OX=3702 GN=At4g28440 PE=1 SV=1
6	AFDB:Q9ZUC0	0.476	0.691	7.563E-8	137	0.118	0.175	Q9ZUC0.pdb.gz	Q9ZUC0_ARATH F5O8.30 protein OS=Arabidopsis thaliana OX=3702 GN=At1g23750 PE=1 SV=1
7	AFDB:Q8RYC3	0.501	0.559	2.581E-7	182	0.113	0.126	Q8RYC3.pdb.gz	Q8RYC3_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g33845 PE=1 SV=1
8	AFDB:Q9XIJ0	0.502	0.660	3.029E-7	153	0.103	0.137	Q9XIJ0.pdb.gz	Q9XIJ0_ARATH Nucleic acid-binding, OB-fold-like protein OS=Arabidopsis thaliana OX=3702 GN=At1g10590 PE=1 SV=1
9	PDB:4owtB	0.285	0.799	5.886E-7	72	0.255	0.722	4owtB.pdb.gz
10	PDB:7qxbP	0.404	0.334	1.684E-4	251	0.098	0.080	7qxbP.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.
11	PDB:2i0qA	0.359	0.172	6.395E-4	461	0.078	0.035	2i0qA.pdb.gz	Structural reorganization and the cooperative binding of single-stranded telomere DNA in Sterkiella nova.
12	AFDB:Q3IJB1	0.302	0.258	1.318E-3	244	0.157	0.131	Q3IJB1.pdb.gz	Q3IJB1_PSET1 Single-stranded DNA-binding protein OS=Pseudoalteromonas translucida (strain TAC 125) OX=326442 GN=ssb PE=3 SV=1
13	AFDB:Q6K0P9	0.363	0.163	3.632E-3	492	0.142	0.059	Q6K0P9.pdb.gz	IFIX_HUMAN Pyrin and HIN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PYHIN1 PE=1 SV=1
14	PDB:6w6wC	0.344	0.225	5.405E-3	323	0.113	0.071	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
15	PDB:6xtx7	0.320	0.129	1.082E-2	598	0.103	0.035	6xtx7.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
16	PDB:6aggZ	0.282	0.156	1.204E-2	420	0.078	0.038	6aggZ.pdb.gz	Structure of tRNA-Modifying Enzyme TiaS and Motions of Its Substrate Binding Zinc Ribbon.
17	PDB:6raz2	0.332	0.131	1.270E-2	559	0.059	0.021	6raz2.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
18	PDB:8d0bA	0.341	0.072	1.270E-2	1116	0.093	0.017	8d0bA.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
19	AFDB:Q9SKI4	0.344	0.120	2.003E-2	640	0.152	0.048	Q9SKI4.pdb.gz	RFA1A_ARATH Replication protein A 70 kDa DNA-binding subunit A OS=Arabidopsis thaliana OX=3702 GN=RPA1A PE=1 SV=1
20	PDB:3k81D	0.280	0.472	2.541E-2	106	0.054	0.104	3k81D.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96AH0	1.53e-152	422	204	1.000	1.000	SOSB2_HUMAN SOSS complex subunit B2 OS=Homo sapiens OX=9606 GN=NABP1 PE=1 SV=1
2	H7C0W4	3.92e-121	342	168	0.819	0.994	H7C0W4_HUMAN Nucleic acid binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=NABP1 PE=1 SV=1
3	Q8BGW5	2.67e-116	330	198	0.814	0.838	SOSB2_MOUSE SOSS complex subunit B2 OS=Mus musculus OX=10090 GN=Nabp1 PE=2 SV=1
4	Q8R2Y9	2.52e-74	225	212	0.598	0.575	SOSB1_MOUSE SOSS complex subunit B1 OS=Mus musculus OX=10090 GN=Nabp2 PE=1 SV=1
5	C9JMP5	1.12e-73	221	151	0.500	0.675	C9JMP5_HUMAN Nucleic acid binding protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=NABP2 PE=1 SV=8
6	Q9BQ15	2.92e-73	222	211	0.515	0.498	SOSB1_HUMAN SOSS complex subunit B1 OS=Homo sapiens OX=9606 GN=NABP2 PE=1 SV=1
7	C9JT95	3.41e-73	219	144	0.515	0.729	C9JT95_HUMAN Nucleic acid binding protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=NABP2 PE=1 SV=1
8	Q384B5	0.21	34.7	463	0.103	0.045	Q384B5_TRYB2 Replication protein A subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0870 PE=3 SV=1
9	Q8RYC3	0.21	33.9	182	0.083	0.093	Q8RYC3_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g33845 PE=1 SV=1
10	O49453	0.30	33.1	153	0.088	0.118	Y4844_ARATH Uncharacterized protein At4g28440 OS=Arabidopsis thaliana OX=3702 GN=At4g28440 PE=1 SV=1
11	Q9ZUC0	0.52	32.3	137	0.127	0.190	Q9ZUC0_ARATH F5O8.30 protein OS=Arabidopsis thaliana OX=3702 GN=At1g23750 PE=1 SV=1
12	Q9XIJ0	0.76	32.0	153	0.069	0.092	Q9XIJ0_ARATH Nucleic acid-binding, OB-fold-like protein OS=Arabidopsis thaliana OX=3702 GN=At1g10590 PE=1 SV=1
13	Q96N06	2.5	30.4	139	0.147	0.216	SPT33_HUMAN Spermatogenesis-associated protein 33 OS=Homo sapiens OX=9606 GN=SPATA33 PE=1 SV=1
14	O00507	6.7	30.0	2555	0.078	0.006	USP9Y_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-Y OS=Homo sapiens OX=9606 GN=USP9Y PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17244 CDC24_OB3	1.5e+02	13.6	Cell division control protein 24, OB domain 3
2	PF01336 tRNA_anti-codon	0.009	27.3	OB-fold nucleic acid binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000403683

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000318641	0.995	Integrator complex subunit 3
2	9606.ENSP00000363360	0.984	SOSS complex subunit C
3	9606.ENSP00000369545	0.905	SOSS complex subunit B1
4	9606.ENSP00000310260	0.873	Integrator complex subunit 6
5	9606.ENSP00000445001	0.825	Integrator complex subunit 11
6	9606.ENSP00000408429	0.767	Integrator complex subunit 14
7	9606.ENSP00000261191	0.755	Integrator complex subunit 13
8	9606.ENSP00000429065	0.747	Integrator complex subunit 9
9	9606.ENSP00000327889	0.746	Integrator complex subunit 5
10	9606.ENSP00000414237	0.743	Integrator complex subunit 2
11	9606.ENSP00000358064	0.739	Regulation of nuclear pre-mRNA domain containing 2
12	9606.ENSP00000381984	0.737	Regulation of nuclear pre-mRNA domain-containing protein 1A
13	9606.ENSP00000415433	0.727	Integrator complex subunit 12
14	9606.ENSP00000365295	0.698	Protein FAM181B
15	9606.ENSP00000362532	0.695	Regulation of nuclear pre-mRNA domain-containing protein 1B
16	9606.ENSP00000385722	0.679	Integrator complex subunit 1
17	9606.ENSP00000480158	0.677	DNA-directed RNA polymerase II subunit RPB1
18	9606.ENSP00000301887	0.654	Basic leucine zipper transcriptional factor ATF-like 2
19	9606.ENSP00000284486	0.653	Protein FAM167A
20	9606.ENSP00000381064	0.632	Integrator complex subunit 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003697	0.991	single-stranded DNA binding
GO:0003723	0.417	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.981	primary metabolic process
GO:0044237	0.981	cellular metabolic process
GO:0006807	0.978	nitrogen compound metabolic process
GO:0043170	0.977	macromolecule metabolic process
GO:0090304	0.968	nucleic acid metabolic process
GO:0048523	0.965	negative regulation of cellular process
GO:1901990	0.946	regulation of mitotic cell cycle phase transition
GO:0006302	0.943	double-strand break repair
GO:1902749	0.936	regulation of cell cycle G2/M phase transition
GO:1901991	0.935	negative regulation of mitotic cell cycle phase transition
GO:0007093	0.935	mitotic cell cycle checkpoint signaling
GO:1902750	0.932	negative regulation of cell cycle G2/M phase transition
GO:0000725	0.908	recombinational repair
GO:0010389	0.873	regulation of G2/M transition of mitotic cell cycle
GO:0000724	0.868	double-strand break repair via homologous recombination
GO:0044818	0.858	mitotic G2/M transition checkpoint
GO:0010212	0.838	response to ionizing radiation
GO:0060255	0.345	regulation of macromolecule metabolic process
GO:0019219	0.305	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005694	0.998	chromosome
GO:0005829	0.996	cytosol
GO:0032991	0.991	protein-containing complex
GO:0140513	0.908	nuclear protein-containing complex
GO:0090734	0.356	site of DNA damage
GO:0035861	0.341	site of double-strand break

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]