StarFunc result for job id Q96AH8

User Input

>input (199 residues)
MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQ
IWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMV
LLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILE
NHLTESIKLSPDQSRSRCC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96AH8	1.000	1.000	2.212E-43	199	1.000	1.000	Q96AH8.pdb.gz	RAB7B_HUMAN Ras-related protein Rab-7b OS=Homo sapiens OX=9606 GN=RAB7B PE=1 SV=1
2	AFDB:Q8VEA8	0.970	0.970	4.535E-40	199	0.884	0.884	Q8VEA8.pdb.gz	RAB7B_MOUSE Ras-related protein Rab-7b OS=Mus musculus OX=10090 GN=Rab7b PE=1 SV=1
3	AFDB:P36411	0.867	0.851	6.634E-26	203	0.477	0.468	P36411.pdb.gz	RAB7A_DICDI Ras-related protein Rab-7a OS=Dictyostelium discoideum OX=44689 GN=rab7A PE=1 SV=1
4	AFDB:B5X127	0.893	0.868	7.541E-26	205	0.467	0.454	B5X127.pdb.gz	B5X127_SALSA Ras-related protein Rab-7a OS=Salmo salar OX=8030 GN=RAB7A PE=2 SV=1
5	AFDB:A0A158RFU6	0.880	0.847	1.627E-25	207	0.492	0.473	A0A158RFU6.pdb.gz	A0A158RFU6_HUMAN RAB7, member RAS oncogene family, isoform CRA_a OS=Homo sapiens OX=9606 GN=RAB7A PE=2 SV=1
6	AFDB:Q23146	0.859	0.819	1.627E-25	209	0.482	0.459	Q23146.pdb.gz	Q23146_CAEEL Ras-related protein Rab-7a OS=Caenorhabditis elegans OX=6239 GN=rab-7 PE=1 SV=1
7	AFDB:C0H516	0.894	0.865	3.292E-25	206	0.437	0.422	C0H516.pdb.gz	C0H516_PLAF7 Ras-related protein RAB7 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0903200 PE=4 SV=1
8	AFDB:O04157	0.930	0.912	3.292E-25	203	0.417	0.409	O04157.pdb.gz	RAG3B_ARATH Ras-related protein RABG3b OS=Arabidopsis thaliana OX=3702 GN=RABG3B PE=1 SV=1
9	AFDB:O76742	0.854	0.823	3.510E-25	207	0.442	0.425	O76742.pdb.gz	O76742_DROME CG5915 protein OS=Drosophila melanogaster OX=7227 GN=Rab7 PE=1 SV=1
10	AFDB:C8VQY7	0.899	0.874	3.742E-25	205	0.457	0.444	C8VQY7.pdb.gz	YPT7_EMENI Ypt/Rab-type GTPase avaA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=avaA PE=1 SV=1
11	PDB:1vg8A	0.837	0.902	7.066E-22	184	0.437	0.473	1vg8A.pdb.gz	Structure of the Rab7:REP-1 complex: insights into the mechanism of Rab prenylation and choroideremia disease
12	PDB:7e1tB	0.830	0.947	3.739E-21	174	0.372	0.425	7e1tB.pdb.gz	Nde1 is a Rab9 effector for loading late endosomes to cytoplasmic dynein motor complex.
13	PDB:5szjA	0.804	0.911	6.656E-21	175	0.312	0.354	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
14	PDB:5szhB	0.817	0.927	8.601E-21	175	0.337	0.383	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
15	PDB:8a4cB	0.800	0.934	1.190E-19	170	0.312	0.365	8a4cB.pdb.gz	Rep15 interacts with several Rab GTPases and has a distinct fold for a Rab effector.
16	PDB:4cz2B	0.804	0.889	1.538E-19	179	0.302	0.335	4cz2B.pdb.gz	Varp is Recruited on to Endosomes by Direct Interaction with Retromer, Where Together They Function in Export to the Cell Surface.
17	PDB:1zbdA	0.830	0.930	1.864E-19	177	0.302	0.339	1zbdA.pdb.gz	Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
18	PDB:6if2B	0.814	0.905	1.864E-19	178	0.322	0.360	6if2B.pdb.gz	Rab35/ACAP2 and Rab35/RUSC2 Complex Structures Reveal Molecular Basis for Effector Recognition by Rab35 GTPase.
19	PDB:2ew1A	0.803	0.929	2.737E-19	171	0.312	0.363	2ew1A.pdb.gz	Crystal structure of RAB30 in complex with a GTP analogue
20	PDB:5sziA	0.827	0.941	5.906E-19	174	0.286	0.328	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96AH8	3.18e-149	414	199	1.000	1.000	RAB7B_HUMAN Ras-related protein Rab-7b OS=Homo sapiens OX=9606 GN=RAB7B PE=1 SV=1
2	Q8VEA8	1.50e-131	369	199	0.884	0.884	RAB7B_MOUSE Ras-related protein Rab-7b OS=Mus musculus OX=10090 GN=Rab7b PE=1 SV=1
3	H9BW96	2.81e-62	194	207	0.482	0.464	RAB7_EPICO Ras-related protein rab7 OS=Epinephelus coioides OX=94232 GN=rab7 PE=1 SV=1
4	Q7T2C6	3.49e-62	194	207	0.482	0.464	Q7T2C6_DANRE RAB7, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab7 PE=1 SV=1
5	P09527	3.77e-62	193	207	0.482	0.464	RAB7A_RAT Ras-related protein Rab-7a OS=Rattus norvegicus OX=10116 GN=Rab7a PE=1 SV=2
6	P18067	7.66e-62	192	207	0.482	0.464	RAB7A_CANLF Ras-related protein Rab-7a OS=Canis lupus familiaris OX=9615 GN=RAB7A PE=1 SV=1
7	A0A158RFU6	7.74e-62	192	207	0.482	0.464	A0A158RFU6_HUMAN RAB7, member RAS oncogene family, isoform CRA_a OS=Homo sapiens OX=9606 GN=RAB7A PE=2 SV=1
8	P51149	7.74e-62	192	207	0.482	0.464	RAB7A_HUMAN Ras-related protein Rab-7a OS=Homo sapiens OX=9606 GN=RAB7A PE=1 SV=1
9	P51150	7.74e-62	192	207	0.482	0.464	RAB7A_MOUSE Ras-related protein Rab-7a OS=Mus musculus OX=10090 GN=Rab7a PE=1 SV=2
10	C0HBN0	5.28e-60	188	205	0.467	0.454	C0HBN0_SALSA Ras-related protein Rab-7a OS=Salmo salar OX=8030 GN=RAB7A PE=2 SV=1
11	B5X431	9.30e-60	187	205	0.467	0.454	B5X431_SALSA Ras-related protein Rab-7a OS=Salmo salar OX=8030 GN=RAB7A PE=2 SV=1
12	B5X127	1.83e-59	186	205	0.462	0.449	B5X127_SALSA Ras-related protein Rab-7a OS=Salmo salar OX=8030 GN=RAB7A PE=2 SV=1
13	Q23146	8.50e-58	182	209	0.477	0.455	Q23146_CAEEL Ras-related protein Rab-7a OS=Caenorhabditis elegans OX=6239 GN=rab-7 PE=1 SV=1
14	P36411	3.37e-56	178	203	0.477	0.468	RAB7A_DICDI Ras-related protein Rab-7a OS=Dictyostelium discoideum OX=44689 GN=rab7A PE=1 SV=1
15	A0A2H3HA93	3.75e-56	178	205	0.452	0.439	A0A2H3HA93_GIBZA Uncharacterized protein OS=Gibberella zeae OX=5518 GN=FUG_LOCUS89406 PE=4 SV=1
16	C8VQY7	4.27e-56	178	205	0.437	0.424	YPT7_EMENI Ypt/Rab-type GTPase avaA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=avaA PE=1 SV=1
17	O76742	8.73e-56	177	207	0.447	0.430	O76742_DROME CG5915 protein OS=Drosophila melanogaster OX=7227 GN=Rab7 PE=1 SV=1
18	C0H516	1.31e-55	177	206	0.442	0.427	C0H516_PLAF7 Ras-related protein RAB7 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0903200 PE=4 SV=1
19	O94655	2.69e-53	171	205	0.432	0.420	YPT7_SCHPO Ypt/Rab-type GTPase ypt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ypt7 PE=3 SV=1
20	Q9LS94	3.16e-53	171	206	0.452	0.437	RAG3F_ARATH Ras-related protein RABG3f OS=Arabidopsis thaliana OX=3702 GN=RABG3F PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	3.8e+02	12.9	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	1.8e+02	13.9	AAA ATPase domain
3	PF13401 AAA_22	57	15.4	AAA domain
4	PF07728 AAA_5	3.1e+02	12.8	AAA domain (dynein-related subfamily)
5	PF00025 Arf	4e-11	54.2	ADP-ribosylation factor family
6	PF03029 ATP_bind_1	9.7	17.5	Conserved hypothetical ATP binding protein
7	PF02492 cobW	37	15.3	CobW/HypB/UreG, nucleotide-binding domain
8	PF00503 G-alpha	5.2	17.7	G-protein alpha subunit
9	PF00009 GTP_EFTU	0.26	22.4	Elongation factor Tu GTP binding domain
10	PF04670 Gtr1_RagA	0.2	22.6	Gtr1/RagA G protein conserved region
11	PF01926 MMR_HSR1	6.1	18.4	50S ribosome-binding GTPase
12	PF10662 PduV-EutP	4.1e+02	12.1	Ethanolamine utilisation - propanediol utilisation
13	PF00071 Ras	1.2e-44	163.3	Ras family
14	PF08477 Roc	3.8e-23	93.4	Ras of Complex, Roc, domain of DAPkinase
15	PF03193 RsgA_GTPase	29	16.0	RsgA GTPase
16	PF00735 Septin	2e+02	12.7	Septin
17	PF09439 SRPRB	1.1	20.2	Signal recognition particle receptor beta subunit
18	PF05272 VirE	2.4e+02	12.6	Virulence-associated protein E

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479762

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350386	0.998	Rab proteins geranylgeranyltransferase component A 1
2	9606.ENSP00000296137	0.997	FYVE and coiled-coil domain-containing protein 1
3	9606.ENSP00000301336	0.997	Rab-interacting lysosomal protein
4	9606.ENSP00000248248	0.989	MON1 homolog B, secretory trafficking associated
5	9606.ENSP00000296473	0.989	Vacuolar fusion protein MON1 homolog A
6	9606.ENSP00000299138	0.986	Vacuolar protein sorting-associated protein 35
7	9606.ENSP00000325681	0.983	CCZ1 homolog, vacuolar protein trafficking and biogenesis associated
8	9606.ENSP00000448182	0.974	TBC1 domain family member 15
9	9606.ENSP00000369810	0.935	Vacuolar protein sorting-associated protein 16 homolog
10	9606.ENSP00000354791	0.932	Dynactin subunit 1
11	9606.ENSP00000335193	0.931	Vam6/Vps39-like protein
12	9606.ENSP00000262039	0.930	Phosphatidylinositol 3-kinase catalytic subunit type 3
13	9606.ENSP00000309457	0.927	Vacuolar protein sorting-associated protein 41 homolog
14	9606.ENSP00000481126	0.927	Vacuolar protein sorting-associated protein 11 homolog
15	9606.ENSP00000298910	0.919	Leucine-rich repeat serine/threonine-protein kinase 2
16	9606.ENSP00000221543	0.918	TBC1 domain family member 17
17	9606.ENSP00000377282	0.909	Protrudin
18	9606.ENSP00000265062	0.908	Ras-related protein Rab-7a
19	9606.ENSP00000463650	0.903	E3 ubiquitin-protein ligase RNF115
20	9606.ENSP00000317955	0.901	Early endosome antigen 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.993	protein binding
GO:0097159	0.863	organic cyclic compound binding
GO:1901363	0.847	heterocyclic compound binding
GO:0003924	0.511	GTPase activity
GO:0019001	0.502	guanyl nucleotide binding
GO:0032561	0.494	guanyl ribonucleotide binding
GO:0043167	0.438	ion binding
GO:0043168	0.423	anion binding
GO:0005525	0.352	GTP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0009987	0.992	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0002682	0.970	regulation of immune system process
GO:0006810	0.930	transport
GO:0019222	0.798	regulation of metabolic process
GO:0050896	0.763	response to stimulus
GO:0044419	0.755	biological process involved in interspecies interaction between organisms
GO:0051641	0.751	cellular localization
GO:0048518	0.732	positive regulation of biological process
GO:0048583	0.706	regulation of response to stimulus
GO:0051716	0.662	cellular response to stimulus
GO:0031323	0.623	regulation of cellular metabolic process
GO:0016192	0.608	vesicle-mediated transport
GO:0071840	0.595	cellular component organization or biogenesis
GO:0051239	0.578	regulation of multicellular organismal process
GO:0016043	0.578	cellular component organization
GO:0032101	0.533	regulation of response to external stimulus
GO:0009607	0.530	response to biotic stimulus
GO:0042221	0.527	response to chemical
GO:0051649	0.505	establishment of localization in cell
GO:0048519	0.497	negative regulation of biological process
GO:0002376	0.487	immune system process
GO:0048522	0.483	positive regulation of cellular process
GO:0046907	0.472	intracellular transport
GO:0060255	0.461	regulation of macromolecule metabolic process
GO:0031347	0.440	regulation of defense response
GO:0023051	0.401	regulation of signaling
GO:0006996	0.383	organelle organization
GO:0008152	0.329	metabolic process
GO:0010646	0.328	regulation of cell communication
GO:0045637	0.300	regulation of myeloid cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031410	1.000	cytoplasmic vesicle
GO:0012505	0.999	endomembrane system
GO:0005773	0.993	vacuole
GO:0016020	0.981	membrane
GO:0005770	0.981	late endosome
GO:0005764	0.976	lysosome
GO:0031090	0.955	organelle membrane
GO:0030139	0.938	endocytic vesicle
GO:0098588	0.905	bounding membrane of organelle
GO:0030659	0.899	cytoplasmic vesicle membrane
GO:0010008	0.818	endosome membrane
GO:0045335	0.799	phagocytic vesicle
GO:0005794	0.767	Golgi apparatus
GO:0005829	0.672	cytosol
GO:0031984	0.391	organelle subcompartment
GO:0098791	0.313	Golgi apparatus subcompartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.511	GTP + H2O = GDP + H(+) + phosphate

[back to server]