StarFunc result for job id Q96AJ9

User Input

>input (217 residues)
MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVR
EIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLD
NTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRI
LTGMLRRIIQNRILLVILGIIVVITILMAITFSVRRH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JI51	0.745	0.726	1.681E-24	224	0.963	0.933	Q9JI51.pdb.gz	VTI1A_RAT Vesicle transport through interaction with t-SNAREs homolog 1A OS=Rattus norvegicus OX=10116 GN=Vti1a PE=1 SV=1
2	AFDB:Q9LVP9	0.856	0.842	4.383E-10	221	0.309	0.303	Q9LVP9.pdb.gz	VTI13_ARATH Vesicle transport v-SNARE 13 OS=Arabidopsis thaliana OX=3702 GN=VTI13 PE=2 SV=1
3	AFDB:Q9SEL6	0.804	0.791	6.618E-10	221	0.327	0.321	Q9SEL6.pdb.gz	VTI11_ARATH Vesicle transport v-SNARE 11 OS=Arabidopsis thaliana OX=3702 GN=VTI11 PE=1 SV=2
4	AFDB:Q9SEL5	0.746	0.732	2.562E-9	222	0.295	0.288	Q9SEL5.pdb.gz	VTI12_ARATH Vesicle transport v-SNARE 12 OS=Arabidopsis thaliana OX=3702 GN=VTI12 PE=1 SV=3
5	AFDB:Q2UJN0	0.733	0.714	3.057E-9	224	0.323	0.312	Q2UJN0.pdb.gz	Q2UJN0_ASPOR t-SNARE coiled-coil homology domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003001144 PE=3 SV=1
6	AFDB:Q04338	0.539	0.539	9.352E-9	217	0.313	0.313	Q04338.pdb.gz	VTI1_YEAST t-SNARE VTI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VTI1 PE=1 SV=3
7	AFDB:Q54CK6	0.638	0.638	3.840E-8	217	0.272	0.272	Q54CK6.pdb.gz	VTI1A_DICDI Vesicle transport through interaction with t-SNAREs homolog 1A OS=Dictyostelium discoideum OX=44689 GN=vti1A PE=1 SV=1
8	AFDB:P78768	0.770	0.780	1.045E-7	214	0.286	0.290	P78768.pdb.gz	VTI1_SCHPO Vesicle transport v-SNARE protein vti1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vti1 PE=2 SV=2
9	AFDB:O88384	0.641	0.608	1.673E-7	232	0.295	0.276	O88384.pdb.gz	VTI1B_MOUSE Vesicle transport through interaction with t-SNAREs homolog 1B OS=Mus musculus OX=10090 GN=Vti1b PE=1 SV=1
10	AFDB:Q9VRL2	0.423	0.425	2.991E-6	216	0.189	0.190	Q9VRL2.pdb.gz	GOSR2_DROME Probable Golgi SNAP receptor complex member 2 OS=Drosophila melanogaster OX=7227 GN=Membrin PE=2 SV=1
11	PDB:3c98B	0.330	0.315	2.008E-2	230	0.055	0.052	3c98B.pdb.gz
12	PDB:7n6g3I	0.244	0.159	1.993E-1	401	0.194	0.105	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
13	PDB:7q83D	0.262	0.334	2.242E-1	156	0.088	0.122	7q83D.pdb.gz
14	PDB:3zc0B	0.262	0.295	6.099E-1	191	0.051	0.058	3zc0B.pdb.gz	Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.
15	PDB:7qpgW	0.264	0.085	6.861E-1	779	0.088	0.024	7qpgW.pdb.gz
16	PDB:1agsA	0.213	0.209	8.682E-1	221	0.060	0.059	1agsA.pdb.gz
17	PDB:1serB	0.278	0.149	8.682E-1	421	0.078	0.040	1serB.pdb.gz	The 2.9 A crystal structure of T. thermophilus seryl-tRNA synthetase complexed with tRNA(Ser).
18	PDB:3jcfA	0.245	0.175	8.682E-1	349	0.092	0.057	3jcfA.pdb.gz
19	PDB:5bw9g	0.164	0.236	9.766E-1	141	0.088	0.135	5bw9g.pdb.gz
20	PDB:7sqcO1	0.240	0.105	9.766E-1	673	0.184	0.059	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96AJ9	1.72e-157	436	217	1.000	1.000	VTI1A_HUMAN Vesicle transport through interaction with t-SNAREs homolog 1A OS=Homo sapiens OX=9606 GN=VTI1A PE=1 SV=2
2	Q9JI51	3.43e-148	413	224	0.963	0.933	VTI1A_RAT Vesicle transport through interaction with t-SNAREs homolog 1A OS=Rattus norvegicus OX=10116 GN=Vti1a PE=1 SV=1
3	Q9LVP9	3.65e-33	120	221	0.318	0.312	VTI13_ARATH Vesicle transport v-SNARE 13 OS=Arabidopsis thaliana OX=3702 GN=VTI13 PE=2 SV=1
4	Q9SEL6	1.22e-32	119	221	0.313	0.308	VTI11_ARATH Vesicle transport v-SNARE 11 OS=Arabidopsis thaliana OX=3702 GN=VTI11 PE=1 SV=2
5	Q9SEL5	1.46e-30	114	222	0.300	0.293	VTI12_ARATH Vesicle transport v-SNARE 12 OS=Arabidopsis thaliana OX=3702 GN=VTI12 PE=1 SV=3
6	Q2UJN0	4.22e-28	107	224	0.318	0.308	Q2UJN0_ASPOR t-SNARE coiled-coil homology domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003001144 PE=3 SV=1
7	P58200	3.38e-26	102	232	0.281	0.263	VTI1B_RAT Vesicle transport through interaction with t-SNAREs homolog 1B OS=Rattus norvegicus OX=10116 GN=Vti1b PE=1 SV=2
8	O88384	1.47e-25	101	232	0.276	0.259	VTI1B_MOUSE Vesicle transport through interaction with t-SNAREs homolog 1B OS=Mus musculus OX=10090 GN=Vti1b PE=1 SV=1
9	Q04338	5.98e-23	94.0	217	0.295	0.295	VTI1_YEAST t-SNARE VTI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VTI1 PE=1 SV=3
10	P78768	3.77e-21	89.4	214	0.295	0.299	VTI1_SCHPO Vesicle transport v-SNARE protein vti1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vti1 PE=2 SV=2
11	Q9UEU0	1.08e-20	88.6	232	0.240	0.224	VTI1B_HUMAN Vesicle transport through interaction with t-SNAREs homolog 1B OS=Homo sapiens OX=9606 GN=VTI1B PE=1 SV=3
12	Q54CK6	7.45e-20	85.9	217	0.263	0.263	VTI1A_DICDI Vesicle transport through interaction with t-SNAREs homolog 1A OS=Dictyostelium discoideum OX=44689 GN=vti1A PE=1 SV=1
13	Q57VM3	6.41e-04	42.0	240	0.217	0.196	Q57VM3_TRYB2 t-SNARE coiled-coil homology domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.570 PE=4 SV=1
14	Q8IKY7	0.031	37.0	253	0.083	0.071	Q8IKY7_PLAF7 SNARE protein, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1448600 PE=4 SV=1
15	G8IHU0	0.30	34.7	3078	0.175	0.012	G8IHU0_DANRE Laminin alpha 2 chain short splice variant OS=Danio rerio OX=7955 GN=Lama2 PE=1 SV=1
16	Q962F3	0.48	32.7	156	0.046	0.064	Q962F3_DROME Gustav OS=Drosophila melanogaster OX=7227 GN=He PE=2 SV=1
17	Q91ZU6	0.50	33.9	7393	0.161	0.005	DYST_MOUSE Dystonin OS=Mus musculus OX=10090 GN=Dst PE=1 SV=2
18	Q8I0K8	0.60	32.3	156	0.046	0.064	Q8I0K8_DROME Hemese, isoform B OS=Drosophila melanogaster OX=7227 GN=He PE=2 SV=1
19	E9PYF4	0.89	33.1	1699	0.138	0.018	E9PYF4_MOUSE LIM domain only 7 OS=Mus musculus OX=10090 GN=Lmo7 PE=1 SV=1
20	Q9VRL2	0.93	32.3	216	0.175	0.176	GOSR2_DROME Probable Golgi SNAP receptor complex member 2 OS=Drosophila melanogaster OX=7227 GN=Membrin PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06022 Cir_Bir_Yir	2.7e+02	12.4	Plasmodium variant antigen protein Cir/Yir/Bir
2	PF07889 DUF1664	47	15.4	Protein of unknown function (DUF1664)
3	PF17274 DUF5339	5.9e+02	12.7	Family of unknown function (DUF5339)
4	PF17279 DUF5344	2e+02	13.9	Family of unknown function (DUF5344)
5	PF05335 DUF745	3.4e+02	12.3	Protein of unknown function (DUF745)
6	PF02601 Exonuc_VII_L	4.1e+02	11.9	Exonuclease VII, large subunit
7	PF15832 FAM27	4e+02	13.0	FAM27 D and E protein family
8	PF00523 Fusion_gly	85	12.9	Fusion glycoprotein F0
9	PF06009 Laminin_II	3.5	19.1	Laminin Domain II
10	PF04791 LMBR1	1.8	19.0	LMBR1-like membrane protein
11	PF09074 Mer2	85	14.4	Mer2
12	PF18548 MetOD2	2.8e+02	13.0	Metanogen output domain 2
13	PF03176 MMPL	49	14.3	MMPL family
14	PF03908 Sec20	5.8	18.2	Sec20
15	PF04048 Sec8_exocyst	2.1e+02	13.2	Sec8 exocyst complex component specific domain
16	PF05008 V-SNARE	2.3e-22	90.5	Vesicle transport v-SNARE protein N-terminus
17	PF12352 V-SNARE_C	1.1e-17	75.4	Snare region anchored in the vesicle membrane C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376792

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000236192	0.999	Vesicle-associated membrane protein 4
2	9606.ENSP00000258301	0.999	Syntaxin-6
3	9606.ENSP00000360183	0.999	Syntaxin-16
4	9606.ENSP00000223369	0.998	Synaptobrevin homolog YKT6
5	9606.ENSP00000294179	0.998	Syntaxin-5
6	9606.ENSP00000054666	0.996	Vesicle-associated membrane protein 3
7	9606.ENSP00000356918	0.993	Syntaxin-7
8	9606.ENSP00000363054	0.993	Syntaxin-12
9	9606.ENSP00000466298	0.993	Syntaxin-10
10	9606.ENSP00000263354	0.977	Alpha-soluble NSF attachment protein
11	9606.ENSP00000220509	0.976	Vacuolar protein sorting-associated protein 18 homolog
12	9606.ENSP00000305255	0.976	Syntaxin-8
13	9606.ENSP00000267199	0.975	Vacuolar protein sorting-associated protein 33A
14	9606.ENSP00000309457	0.974	Vacuolar protein sorting-associated protein 41 homolog
15	9606.ENSP00000369810	0.974	Vacuolar protein sorting-associated protein 16 homolog
16	9606.ENSP00000262640	0.962	Vesicle-associated membrane protein 7
17	9606.ENSP00000482826	0.954	Beta-soluble NSF attachment protein
18	9606.ENSP00000225724	0.951	Golgi SNAP receptor complex member 1
19	9606.ENSP00000225567	0.942	Golgi SNAP receptor complex member 2
20	9606.ENSP00000358126	0.937	Vacuolar protein sorting-associated protein 45

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030674	0.631	protein-macromolecule adaptor activity
GO:0005484	0.431	SNAP receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016192	0.996	vesicle-mediated transport
GO:0009987	0.995	cellular process
GO:0051641	0.986	cellular localization
GO:0016197	0.983	endosomal transport
GO:0016043	0.927	cellular component organization
GO:0006996	0.718	organelle organization
GO:0061024	0.648	membrane organization
GO:0008152	0.551	metabolic process
GO:0048193	0.548	Golgi vesicle transport
GO:0061025	0.495	membrane fusion
GO:0010256	0.461	endomembrane system organization
GO:0016050	0.395	vesicle organization
GO:0044237	0.355	cellular metabolic process
GO:0048284	0.329	organelle fusion
GO:0065007	0.325	biological regulation
GO:0090174	0.309	organelle membrane fusion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0032991	0.998	protein-containing complex
GO:0031090	0.998	organelle membrane
GO:0098588	0.994	bounding membrane of organelle
GO:0005773	0.994	vacuole
GO:0098796	0.990	membrane protein complex
GO:0031201	0.959	SNARE complex
GO:0031984	0.925	organelle subcompartment
GO:0031982	0.921	vesicle
GO:0005802	0.912	trans-Golgi network
GO:0031410	0.868	cytoplasmic vesicle
GO:0005768	0.860	endosome
GO:0000139	0.848	Golgi membrane
GO:0032588	0.841	trans-Golgi network membrane
GO:0071944	0.765	cell periphery
GO:0005886	0.740	plasma membrane
GO:0030659	0.729	cytoplasmic vesicle membrane
GO:0000323	0.589	lytic vacuole
GO:0005776	0.528	autophagosome
GO:0048471	0.515	perinuclear region of cytoplasm
GO:0005764	0.414	lysosome
GO:0099503	0.387	secretory vesicle
GO:0030054	0.344	cell junction
GO:0005829	0.312	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]