StarFunc result for job id Q96AP0

User Input

>input (458 residues)
MAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLV
SDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQV
DRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEHLSESTSSNAGLSLSQLLDEMREDQE
HQGALVCLAESCLTLEGPCTAPPVTHWAASRCKATGEAVYTVPSSMLCISENDQLILSSL
GPCQRTQGPELPPPDPALQDLSLTLIASPPSSPSSSGTPALPGHMSSEESGTSISLLPAL
SLAAPDPGQRSSSQPSPAICSAPATLTPRSPHASRTPSSPLQSCTPSLSPRSHVPSPHQA
LVTRPQKPSLEFKEFVGLPCKNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEP
PCTSLCARVQAVRLPPQLMAWALHFLMDAQPGSEPTPM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96AP0	0.999	0.999	1.954E-76	458	1.000	1.000	Q96AP0.pdb.gz	ACD_HUMAN Adrenocortical dysplasia protein homolog OS=Homo sapiens OX=9606 GN=ACD PE=1 SV=4
2	AFDB:Q5EE38	0.398	0.435	2.005E-44	416	0.585	0.644	Q5EE38.pdb.gz	ACD_MOUSE Adrenocortical dysplasia protein OS=Mus musculus OX=10090 GN=Acd PE=1 SV=1
3	PDB:7qxaO	0.257	0.928	1.243E-18	122	0.262	0.984	7qxaO.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.
4	PDB:2i0qB	0.221	0.427	1.107E-5	216	0.050	0.106	2i0qB.pdb.gz	Structural reorganization and the cooperative binding of single-stranded telomere DNA in Sterkiella nova.
5	PDB:7uy5G	0.185	0.349	1.825E-4	208	0.037	0.082	7uy5G.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
6	PDB:2m9vA	0.193	0.470	2.459E-4	170	0.041	0.112	2m9vA.pdb.gz
7	AFDB:P91399	0.100	0.058	6.059E-4	926	0.118	0.058	P91399.pdb.gz	RMI1_CAEEL RecQ-mediated genome instability protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=rmh-1 PE=1 SV=1
8	PDB:7uy7B	0.163	0.242	2.835E-3	291	0.046	0.072	7uy7B.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
9	PDB:4abnB	0.145	0.155	4.568E-3	426	0.024	0.026	4abnB.pdb.gz
10	PDB:7qwsK	0.177	0.189	7.814E-3	426	0.037	0.040	7qwsK.pdb.gz	Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
11	PDB:6raz2	0.134	0.113	8.804E-3	559	0.031	0.025	6raz2.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
12	PDB:4j15A	0.174	0.183	9.919E-3	431	0.037	0.039	4j15A.pdb.gz
13	PDB:5zg8A	0.162	0.175	2.575E-2	422	0.061	0.066	5zg8A.pdb.gz
14	AFDB:Q8CJH2	0.099	0.088	8.056E-2	555	0.151	0.124	Q8CJH2.pdb.gz	DAB1_RAT Disabled homolog 1 OS=Rattus norvegicus OX=10116 GN=Dab1 PE=1 SV=1
15	AFDB:H0ZH85	0.121	0.107	1.085E-1	557	0.155	0.127	H0ZH85.pdb.gz	H0ZH85_TAEGU DAB adaptor protein 1 OS=Taeniopygia guttata OX=59729 GN=DAB1 PE=4 SV=2
16	AFDB:F1RMT5	0.056	0.039	1.152E-1	808	0.142	0.080	F1RMT5.pdb.gz	F1RMT5_PIG Diaphanous related formin 1 OS=Sus scrofa OX=9823 GN=DIAPH1 PE=1 SV=5
17	AFDB:Q9XZL7	0.076	0.036	1.462E-1	1190	0.153	0.059	Q9XZL7.pdb.gz	Q9XZL7_DROME Transforming acidic coiled-coil containing protein OS=Drosophila melanogaster OX=7227 GN=tacc PE=2 SV=1
18	AFDB:Q66T02	0.110	0.062	2.818E-1	1073	0.168	0.072	Q66T02.pdb.gz	PKHG5_MOUSE Pleckstrin homology domain-containing family G member 5 OS=Mus musculus OX=10090 GN=Plekhg5 PE=1 SV=1
19	AFDB:R9QT79	0.061	0.030	3.370E-1	1132	0.142	0.057	R9QT79.pdb.gz	R9QT79_ONCMY Long-form leptin receptor OS=Oncorhynchus mykiss OX=8022 GN=LepR PE=2 SV=1
20	AFDB:F1QUB9	0.087	0.047	4.031E-1	1065	0.151	0.065	F1QUB9.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96AP0	0.0	912	458	1.000	1.000	ACD_HUMAN Adrenocortical dysplasia protein homolog OS=Homo sapiens OX=9606 GN=ACD PE=1 SV=4
2	R4GMR6	0.0	538	334	0.614	0.841	R4GMR6_HUMAN ACD shelterin complex subunit and telomerase recruitment factor OS=Homo sapiens OX=9606 GN=ACD PE=1 SV=2
3	R4GNJ5	0.0	865	442	0.965	1.000	R4GNJ5_HUMAN ACD shelterin complex subunit and telomerase recruitment factor OS=Homo sapiens OX=9606 GN=ACD PE=1 SV=2
4	Q5EE38	4.78e-170	486	416	0.585	0.644	ACD_MOUSE Adrenocortical dysplasia protein OS=Mus musculus OX=10090 GN=Acd PE=1 SV=1
5	Q4QHH1	0.30	36.2	602	0.066	0.050	Q4QHH1_LEIMA Leishmanolysin OS=Leishmania major OX=5664 GN=GP63-2 PE=3 SV=1
6	Q4QHH2	0.31	35.8	602	0.066	0.050	Q4QHH2_LEIMA Leishmanolysin OS=Leishmania major OX=5664 GN=GP63-1 PE=3 SV=1
7	P08148	0.63	35.0	602	0.063	0.048	GP63_LEIMA Leishmanolysin OS=Leishmania major OX=5664 GN=gp63 PE=1 SV=2
8	Q4QHG9	5.4	32.0	602	0.059	0.045	Q4QHG9_LEIMA Leishmanolysin OS=Leishmania major OX=5664 GN=GP63-4 PE=3 SV=1
9	A8MTQ0	6.2	31.2	251	0.050	0.092	NOTO_HUMAN Homeobox protein notochord OS=Homo sapiens OX=9606 GN=NOTO PE=1 SV=2
10	Q91562	8.9	31.6	1427	0.059	0.019	Q91562_XENLA Deleted in colorectal carcinoma OS=Xenopus laevis OX=8355 GN=dcc.L PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07404 TEBP_beta	9.9e+02	10.9	Telomere-binding protein beta subunit (TEBP beta)
2	PF10341 TPP1	2e-18	77.7	Shelterin complex subunit, TPP1/ACD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483117

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267415	0.999	TERF1-interacting nuclear factor 2
2	9606.ENSP00000276603	0.999	Telomeric repeat-binding factor 1
3	9606.ENSP00000350249	0.999	Protection of telomeres protein 1
4	9606.ENSP00000300086	0.997	Telomeric repeat-binding factor 2-interacting protein 1
5	9606.ENSP00000254942	0.990	Telomeric repeat-binding factor 2
6	9606.ENSP00000298139	0.937	Werner syndrome ATP-dependent helicase
7	9606.ENSP00000358576	0.937	5' exonuclease Apollo
8	9606.ENSP00000309572	0.932	Telomerase reverse transcriptase
9	9606.ENSP00000347232	0.924	Bloom syndrome protein
10	9606.ENSP00000380762	0.919	CST complex subunit TEN1
11	9606.ENSP00000305480	0.916	Flap endonuclease 1
12	9606.ENSP00000224950	0.907	CST complex subunit STN1
13	9606.ENSP00000263274	0.907	DNA ligase 1
14	9606.ENSP00000328174	0.904	ATP-dependent DNA helicase PIF1
15	9606.ENSP00000377390	0.902	Serine/threonine-protein phosphatase 6 regulatory subunit 3
16	9606.ENSP00000255465	0.900	Cyclin-A1
17	9606.ENSP00000266970	0.900	Cyclin-dependent kinase 2
18	9606.ENSP00000274026	0.900	Cyclin-A2
19	9606.ENSP00000382379	0.900	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A
20	9606.ENSP00000392147	0.900	Protein phosphatase 6 catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0070182	1.000	DNA polymerase binding
GO:0042162	1.000	telomeric DNA binding
GO:0003824	0.310	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0006807	0.982	nitrogen compound metabolic process
GO:0051054	0.978	positive regulation of DNA metabolic process
GO:0045934	0.977	negative regulation of nucleobase-containing compound metabolic process
GO:0043170	0.976	macromolecule metabolic process
GO:0050790	0.975	regulation of catalytic activity
GO:0016043	0.967	cellular component organization
GO:0010605	0.966	negative regulation of macromolecule metabolic process
GO:2001251	0.965	negative regulation of chromosome organization
GO:1901360	0.962	organic cyclic compound metabolic process
GO:0006725	0.962	cellular aromatic compound metabolic process
GO:0034641	0.962	cellular nitrogen compound metabolic process
GO:0051338	0.950	regulation of transferase activity
GO:0090304	0.941	nucleic acid metabolic process
GO:0051053	0.941	negative regulation of DNA metabolic process
GO:0033365	0.935	protein localization to organelle
GO:0044093	0.934	positive regulation of molecular function
GO:0006259	0.927	DNA metabolic process
GO:0051276	0.926	chromosome organization
GO:0034502	0.911	protein localization to chromosome
GO:0000723	0.909	telomere maintenance
GO:2000278	0.907	regulation of DNA biosynthetic process
GO:2001252	0.904	positive regulation of chromosome organization
GO:0032204	0.885	regulation of telomere maintenance
GO:0051972	0.883	regulation of telomerase activity
GO:2000279	0.877	negative regulation of DNA biosynthetic process
GO:0032206	0.816	positive regulation of telomere maintenance
GO:1904356	0.813	regulation of telomere maintenance via telomere lengthening
GO:0051098	0.802	regulation of binding
GO:0032210	0.800	regulation of telomere maintenance via telomerase
GO:0016233	0.754	telomere capping
GO:0051101	0.741	regulation of DNA binding
GO:0051099	0.708	positive regulation of binding
GO:0010557	0.647	positive regulation of macromolecule biosynthetic process
GO:0031328	0.644	positive regulation of cellular biosynthetic process
GO:0043388	0.620	positive regulation of DNA binding
GO:0044085	0.616	cellular component biogenesis
GO:2000573	0.564	positive regulation of DNA biosynthetic process
GO:0043085	0.533	positive regulation of catalytic activity
GO:0051234	0.487	establishment of localization
GO:0050896	0.463	response to stimulus
GO:0051347	0.450	positive regulation of transferase activity
GO:0022607	0.429	cellular component assembly
GO:0051716	0.366	cellular response to stimulus
GO:0045184	0.366	establishment of protein localization
GO:0051973	0.361	positive regulation of telomerase activity
GO:0006950	0.360	response to stress
GO:0071705	0.355	nitrogen compound transport
GO:0032205	0.338	negative regulation of telomere maintenance
GO:0071702	0.332	organic substance transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0016604	1.000	nuclear body
GO:0000781	0.997	chromosome, telomeric region
GO:0140513	0.993	nuclear protein-containing complex
GO:0032993	0.989	protein-DNA complex
GO:0044815	0.960	DNA packaging complex
GO:0000782	0.835	telomere cap complex
GO:0000783	0.768	nuclear telomere cap complex
GO:0070187	0.384	shelterin complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]