StarFunc result for job id Q96AP7

User Input

>input (390 residues)
MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEV
SSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKD
SGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSK
PAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLE
VSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKS
SDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISP
IPGGVSSSGLSRMGAVPVMVPAQSQAGSLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96AP7	1.000	1.000	1.115E-65	390	1.000	1.000	Q96AP7.pdb.gz	ESAM_HUMAN Endothelial cell-selective adhesion molecule OS=Homo sapiens OX=9606 GN=ESAM PE=1 SV=1
2	AFDB:Q925F2	0.698	0.692	4.939E-50	394	0.728	0.721	Q925F2.pdb.gz	ESAM_MOUSE Endothelial cell-selective adhesion molecule OS=Mus musculus OX=10090 GN=Esam PE=1 SV=1
3	AFDB:B0CLV1	0.530	0.488	2.242E-28	428	0.385	0.350	B0CLV1.pdb.gz	B0CLV1_DANRE Endothelial cell-selective adhesion molecule precursor OS=Danio rerio OX=7955 GN=ESAM PE=2 SV=1
4	AFDB:A0A2R8RYG1	0.497	0.443	5.573E-25	442	0.315	0.278	A0A2R8RYG1.pdb.gz
5	AFDB:Q5DX21	0.480	0.438	1.980E-24	431	0.254	0.230	Q5DX21.pdb.gz	IGS11_HUMAN Immunoglobulin superfamily member 11 OS=Homo sapiens OX=9606 GN=IGSF11 PE=1 SV=3
6	AFDB:P0C673	0.492	0.453	2.500E-23	428	0.244	0.222	P0C673.pdb.gz	IGS11_MOUSE Immunoglobulin superfamily member 11 OS=Mus musculus OX=10090 GN=Igsf11 PE=1 SV=1
7	AFDB:Q86XK7	0.451	0.454	1.861E-22	387	0.215	0.217	Q86XK7.pdb.gz	VSIG1_HUMAN V-set and immunoglobulin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=VSIG1 PE=1 SV=1
8	AFDB:Q96IQ7	0.435	0.510	1.861E-22	327	0.251	0.300	Q96IQ7.pdb.gz	VSIG2_HUMAN V-set and immunoglobulin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=VSIG2 PE=1 SV=1
9	AFDB:A4JYS5	0.441	0.556	1.314E-21	298	0.195	0.255	A4JYS5.pdb.gz	A4JYS5_DANRE Uncharacterized protein LOC792578 OS=Danio rerio OX=7955 GN=zgc:165604 PE=1 SV=1
10	AFDB:F8W2R4	0.387	0.344	2.256E-18	451	0.187	0.162	F8W2R4.pdb.gz
11	PDB:6dlfA	0.351	0.548	1.448E-10	236	0.095	0.157	6dlfA.pdb.gz
12	PDB:6dldD	0.363	0.504	2.096E-10	269	0.113	0.164	6dldD.pdb.gz
13	PDB:5c7kF	0.216	0.368	1.828E-9	212	0.092	0.170	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
14	PDB:5c6wJ	0.219	0.342	9.911E-9	238	0.092	0.151	5c6wJ.pdb.gz
15	PDB:1gpoM	0.238	0.399	3.006E-8	218	0.077	0.138	1gpoM.pdb.gz
16	PDB:2qhrL	0.261	0.392	3.340E-8	218	0.100	0.179	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
17	PDB:2jb5L	0.222	0.377	3.713E-8	211	0.110	0.204	2jb5L.pdb.gz	Fab Mor03268 Triggers Absorption Shift of a Diagnostic Dye Via Packaging in a Solvent-Shielded Fab Dimer Interface
18	PDB:3c2aL	0.221	0.376	4.126E-8	216	0.115	0.208	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
19	PDB:3u7wL	0.209	0.366	4.586E-8	210	0.085	0.157	3u7wL.pdb.gz
20	PDB:1ngwH	0.208	0.347	5.665E-8	216	0.105	0.190	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96AP7	0.0	781	390	1.000	1.000	ESAM_HUMAN Endothelial cell-selective adhesion molecule OS=Homo sapiens OX=9606 GN=ESAM PE=1 SV=1
2	Q925F2	1.84e-179	506	394	0.726	0.718	ESAM_MOUSE Endothelial cell-selective adhesion molecule OS=Mus musculus OX=10090 GN=Esam PE=1 SV=1
3	B0CLV1	9.06e-68	222	428	0.387	0.353	B0CLV1_DANRE Endothelial cell-selective adhesion molecule precursor OS=Danio rerio OX=7955 GN=ESAM PE=2 SV=1
4	P97792	1.07e-31	125	365	0.295	0.315	CXAR_MOUSE Coxsackievirus and adenovirus receptor homolog OS=Mus musculus OX=10090 GN=Cxadr PE=1 SV=1
5	Q9R066	1.74e-31	124	365	0.292	0.312	CXAR_RAT Coxsackievirus and adenovirus receptor homolog OS=Rattus norvegicus OX=10116 GN=Cxadr PE=1 SV=2
6	P78310	3.39e-25	107	365	0.272	0.290	CXAR_HUMAN Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR PE=1 SV=1
7	Q5U2P2	3.16e-24	105	428	0.282	0.257	IGS11_RAT Immunoglobulin superfamily member 11 OS=Rattus norvegicus OX=10116 GN=Igsf11 PE=2 SV=1
8	Q90Y50	3.18e-24	104	372	0.231	0.242	CXAR_DANRE Coxsackievirus and adenovirus receptor homolog OS=Danio rerio OX=7955 GN=cxadr PE=2 SV=1
9	P0C673	3.80e-24	105	428	0.295	0.269	IGS11_MOUSE Immunoglobulin superfamily member 11 OS=Mus musculus OX=10090 GN=Igsf11 PE=1 SV=1
10	Q99795	4.82e-24	103	319	0.218	0.266	GPA33_HUMAN Cell surface A33 antigen OS=Homo sapiens OX=9606 GN=GPA33 PE=1 SV=1
11	Q9D2J4	8.52e-24	103	407	0.251	0.241	VSIG1_MOUSE V-set and immunoglobulin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Vsig1 PE=1 SV=1
12	Q5DX21	3.00e-22	99.8	431	0.287	0.260	IGS11_HUMAN Immunoglobulin superfamily member 11 OS=Homo sapiens OX=9606 GN=IGSF11 PE=1 SV=3
13	Q96IQ7	5.65e-21	94.7	327	0.264	0.315	VSIG2_HUMAN V-set and immunoglobulin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=VSIG2 PE=1 SV=1
14	Q86XK7	1.11e-20	94.7	387	0.203	0.204	VSIG1_HUMAN V-set and immunoglobulin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=VSIG1 PE=1 SV=1
15	Q9JKA5	1.75e-20	93.2	319	0.208	0.254	GPA33_MOUSE Cell surface A33 antigen OS=Mus musculus OX=10090 GN=Gpa33 PE=2 SV=2
16	Q9H6B4	5.06e-19	89.7	373	0.262	0.273	CLMP_HUMAN CXADR-like membrane protein OS=Homo sapiens OX=9606 GN=CLMP PE=1 SV=1
17	Q8K1G0	8.29e-19	89.4	372	0.190	0.199	CLMP_RAT CXADR-like membrane protein OS=Rattus norvegicus OX=10116 GN=Clmp PE=2 SV=1
18	Q66I72	5.91e-14	73.9	292	0.149	0.199	Q66I72_DANRE Junctional adhesion molecule A OS=Danio rerio OX=7955 GN=JAM PE=1 SV=1
19	A4JYS5	3.31e-13	72.0	298	0.167	0.218	A4JYS5_DANRE Uncharacterized protein LOC792578 OS=Danio rerio OX=7955 GN=zgc:165604 PE=1 SV=1
20	P57087	9.81e-12	67.4	298	0.108	0.141	JAM2_HUMAN Junctional adhesion molecule B OS=Homo sapiens OX=9606 GN=JAM2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	3.5e+02	12.7	CD80-like C2-set immunoglobulin domain
2	PF07679 I-set	2.5e-06	38.8	Immunoglobulin I-set domain
3	PF00047 ig	0.00096	30.6	Immunoglobulin domain
4	PF13895 Ig_2	8.9e-06	37.3	Immunoglobulin domain
5	PF13927 Ig_3	6.6e-10	50.7	Immunoglobulin domain
6	PF18452 Ig_6	8.6	17.6	Immunoglobulin domain
7	PF11465 Receptor_2B4	1.3e+02	14.1	Natural killer cell receptor 2B4
8	PF07686 V-set	1.7e-12	58.8	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000278927

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385477	0.843	Claudin-5
2	9606.ENSP00000347379	0.776	Occludin
3	9606.ENSP00000380131	0.776	Claudin-6
4	9606.ENSP00000321573	0.740	Discoidin, CUB and LCCL domain containing 2
5	9606.ENSP00000457421	0.734	Platelet endothelial cell adhesion molecule
6	9606.ENSP00000344115	0.685	Cadherin-5
7	9606.ENSP00000378577	0.681	Claudin-3
8	9606.ENSP00000064724	0.669	Claudin-11
9	9606.ENSP00000228463	0.668	P-selectin glycoprotein ligand 1
10	9606.ENSP00000385300	0.659	Claudin-15
11	9606.ENSP00000441283	0.655	Claudin-2
12	9606.ENSP00000384126	0.652	Leucine-rich repeat-containing protein 32
13	9606.ENSP00000356790	0.649	Sodium/potassium-transporting ATPase subunit beta-1
14	9606.ENSP00000296387	0.647	Claudin-19
15	9606.ENSP00000331736	0.645	E-selectin
16	9606.ENSP00000318113	0.641	Claudin-22
17	9606.ENSP00000264734	0.636	Claudin-16
18	9606.ENSP00000295522	0.635	Claudin-1
19	9606.ENSP00000398017	0.632	Claudin-9
20	9606.ENSP00000294728	0.631	Vascular cell adhesion protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0098632	0.995	cell-cell adhesion mediator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0016043	0.954	cellular component organization
GO:0007155	0.944	cell adhesion
GO:0098609	0.921	cell-cell adhesion
GO:0045216	0.854	cell-cell junction organization
GO:0120193	0.798	tight junction organization
GO:0051128	0.772	regulation of cellular component organization
GO:0065008	0.752	regulation of biological quality
GO:0044087	0.741	regulation of cellular component biogenesis
GO:0007043	0.699	cell-cell junction assembly
GO:0048518	0.670	positive regulation of biological process
GO:0032970	0.664	regulation of actin filament-based process
GO:0048522	0.631	positive regulation of cellular process
GO:0043254	0.566	regulation of protein-containing complex assembly
GO:0033043	0.565	regulation of organelle organization
GO:0050896	0.549	response to stimulus
GO:0032956	0.549	regulation of actin cytoskeleton organization
GO:1902903	0.536	regulation of supramolecular fiber organization
GO:0043297	0.535	apical junction assembly
GO:0110053	0.451	regulation of actin filament organization
GO:0032271	0.381	regulation of protein polymerization
GO:0048856	0.359	anatomical structure development
GO:0032501	0.357	multicellular organismal process
GO:2000249	0.357	regulation of actin cytoskeleton reorganization
GO:0120192	0.331	tight junction assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005911	0.999	cell-cell junction
GO:0032991	0.980	protein-containing complex
GO:0043226	0.728	organelle
GO:0005622	0.661	intracellular anatomical structure
GO:0043296	0.640	apical junction complex
GO:0070160	0.638	tight junction
GO:0043229	0.617	intracellular organelle
GO:0043227	0.615	membrane-bounded organelle
GO:0005923	0.601	bicellular tight junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]