StarFunc result for job id Q96AQ6

User Input

>input (731 residues)
MASCPDSDNSWVLAGSESLPVETLGPASRMDPESERALQAPHSPSKTDGKELAGTMDGEG
TLFQTESPQSGSILTEETEVKGTLEGDVCGVEPPGPGDTVVQGDLQETTVVTGLGPDTQD
LEGQSPPQSLPSTPKAAWIREEGRCSSSDDDTDVDMEGLRRRRGREAGPPQPMVPLAVEN
QAGGEGAGGELGISLNMCLLGALVLLGLGVLLFSGGLSESETGPMEEVERQVLPDPEVLE
AVGDRQDGLREQLQAPVPPDSVPSLQNMGLLLDKLAKENQDIRLLQAQLQAQKEELQSLM
HQPKGLEEENAQLRGALQQGEAFQRALESELQQLRARLQGLEADCVRGPDGVCLSGGRGP
QGDKAIREQGPREQEPELSFLKQKEQLEAEAQALRQELERQRRLLGSVQQDLERSLQDAS
RGDPAHAGLAELGHRLAQKLQGLENWGQDPGVSANASKAWHQKSHFQNSREWSGKEKWWD
GQRDRKAEHWKHKKEESGRERKKNWGGQEDREPAGRWKEGRPRVEESGSKKEGKRQGPKE
PPRKSGSFHSSGEKQKQPRWREGTKDSHDPLPSWAELLRPKYRAPQGCSGVDECARQEGL
TFFGTELAPVRQQELASLLRTYLARLPWAGQLTKELPLSPAFFGEDGIFRHDRLRFRDFV
DALEDSLEEVAVQQTGDDDEVDDFEDFIFSHFFGDKALKKRSGKKDKHSQSPRAAGPREG
HSHSHHHHHRG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96AQ6	1.000	1.000	1.635E-102	731	1.000	1.000	Q96AQ6.pdb.gz	PBIP1_HUMAN Pre-B-cell leukemia transcription factor-interacting protein 1 OS=Homo sapiens OX=9606 GN=PBXIP1 PE=1 SV=1
2	AFDB:Q5SZL2	0.090	0.083	9.594E-4	805	0.104	0.094	Q5SZL2.pdb.gz	CE85L_HUMAN Centrosomal protein of 85 kDa-like OS=Homo sapiens OX=9606 GN=CEP85L PE=1 SV=1
3	AFDB:Q86YS3	0.068	0.075	1.146E-3	637	0.120	0.138	Q86YS3.pdb.gz	RFIP4_HUMAN Rab11 family-interacting protein 4 OS=Homo sapiens OX=9606 GN=RAB11FIP4 PE=1 SV=1
4	AFDB:Q9VTN6	0.102	0.084	1.451E-3	928	0.114	0.089	Q9VTN6.pdb.gz	Q9VTN6_DROME Twitchy OS=Drosophila melanogaster OX=7227 GN=twy PE=4 SV=1
5	AFDB:P34402	0.084	0.077	2.780E-3	808	0.101	0.092	P34402.pdb.gz	SAS4_CAEEL Spindle assembly abnormal protein 4 OS=Caenorhabditis elegans OX=6239 GN=sas-4 PE=1 SV=2
6	AFDB:Q8IWC1	0.095	0.081	3.320E-3	876	0.127	0.106	Q8IWC1.pdb.gz	MA7D3_HUMAN MAP7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAP7D3 PE=1 SV=2
7	AFDB:O70622	0.058	0.078	3.964E-3	471	0.112	0.174	O70622.pdb.gz	RTN2_MOUSE Reticulon-2 OS=Mus musculus OX=10090 GN=Rtn2 PE=1 SV=1
8	AFDB:C8VIR1	0.070	0.044	8.058E-3	1207	0.109	0.066	C8VIR1.pdb.gz	C8VIR1_EMENI Calmodulin-binding coil-coil protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03062 PE=4 SV=1
9	AFDB:F4HXQ7	0.084	0.060	8.549E-3	1113	0.105	0.069	F4HXQ7.pdb.gz	MYOB1_ARATH Myosin-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=MYOB1 PE=1 SV=1
10	AFDB:Q3LGD4	0.065	0.075	1.149E-2	621	0.101	0.119	Q3LGD4.pdb.gz	RFP4A_DANRE Rab11 family-interacting protein 4A OS=Danio rerio OX=7955 GN=rab11fip4a PE=2 SV=1
11	PDB:1pc2A	0.049	0.128	2.609	152	0.042	0.204	1pc2A.pdb.gz
12	PDB:7d6dA	0.081	0.139	3.946	380	0.026	0.050	7d6dA.pdb.gz
13	PDB:3euhB	0.047	0.087	4.441	321	0.029	0.065	3euhB.pdb.gz
14	PDB:6f1eA	0.047	0.201	4.999	143	0.014	0.070	6f1eA.pdb.gz
15	PDB:6hd7t	0.041	0.037	5.969	838	0.026	0.023	6hd7t.pdb.gz	Ribosome-NatA architecture reveals that rRNA expansion segments coordinate N-terminal acetylation.
16	PDB:7st9A	0.038	0.050	7.127	522	0.016	0.023	7st9A.pdb.gz	Mechanisms of loading and release of the 9-1-1 checkpoint clamp.
17	PDB:2ygwA	0.051	0.076	8.021	416	0.037	0.065	2ygwA.pdb.gz
18	PDB:4v4kY	0.069	0.190	8.021	146	0.026	0.130	4v4kY.pdb.gz
19	PDB:5jk7F	0.047	0.323	9.028	74	0.021	0.203	5jk7F.pdb.gz
20	PDB:4k1cA	0.049	0.074	9.578	374	0.025	0.048	4k1cA.pdb.gz	Structural basis for alternating access of a eukaryotic calcium/proton exchanger.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3TVI8	0.0	841	727	0.709	0.713	PBIP1_MOUSE Pre-B-cell leukemia transcription factor-interacting protein 1 OS=Mus musculus OX=10090 GN=Pbxip1 PE=1 SV=2
2	Q96AQ6	0.0	1459	731	1.000	1.000	PBIP1_HUMAN Pre-B-cell leukemia transcription factor-interacting protein 1 OS=Homo sapiens OX=9606 GN=PBXIP1 PE=1 SV=1
3	Q9ULG6	3.70e-20	97.8	757	0.224	0.217	CCPG1_HUMAN Cell cycle progression protein 1 OS=Homo sapiens OX=9606 GN=CCPG1 PE=1 SV=3
4	Q640L3	1.05e-15	83.6	753	0.219	0.212	CCPG1_MOUSE Cell cycle progression protein 1 OS=Mus musculus OX=10090 GN=Ccpg1 PE=1 SV=2
5	Q8IDX6	0.044	40.0	3130	0.051	0.012	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
6	P54265	0.26	37.0	631	0.056	0.065	DMPK_MOUSE Myotonin-protein kinase OS=Mus musculus OX=10090 GN=Dmpk PE=1 SV=1
7	Q93XZ7	0.30	36.2	218	0.048	0.161	Q93XZ7_ARATH Endoplasmic reticulum transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=At5g42570 PE=1 SV=1
8	Q6VGS5	0.35	37.0	2009	0.036	0.013	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1
9	Q8N5R6	0.51	36.2	958	0.057	0.044	CCD33_HUMAN Coiled-coil domain-containing protein 33 OS=Homo sapiens OX=9606 GN=CCDC33 PE=1 SV=3
10	D3ZYD7	0.83	35.8	1523	0.068	0.033	D3ZYD7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=1 SV=4
11	A0A8I5ZW24	0.92	35.4	1845	0.068	0.027	A0A8I5ZW24_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
12	A0A8I6A5W7	0.94	35.4	1873	0.068	0.027	A0A8I6A5W7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
13	Q960Y8	1.4	34.7	874	0.049	0.041	Q960Y8_DROME Aluminum tubes, isoform G OS=Drosophila melanogaster OX=7227 GN=alt PE=1 SV=1
14	Q9VEH0	1.7	34.7	842	0.049	0.043	Q9VEH0_DROME Aluminum tubes, isoform A OS=Drosophila melanogaster OX=7227 GN=alt PE=1 SV=1
15	Q9R182	1.8	34.3	455	0.063	0.101	ANGL3_MOUSE Angiopoietin-related protein 3 OS=Mus musculus OX=10090 GN=Angptl3 PE=1 SV=1
16	P61952	2.1	31.2	73	0.021	0.205	GBG11_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11 OS=Homo sapiens OX=9606 GN=GNG11 PE=1 SV=1
17	Q53Y01	2.1	31.2	73	0.021	0.205	Q53Y01_HUMAN Guanine nucleotide-binding protein subunit gamma OS=Homo sapiens OX=9606 GN=GNG11 PE=1 SV=1
18	Q5SNZ0	2.1	34.3	1873	0.062	0.024	GRDN_MOUSE Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2
19	A4GSN8	2.3	34.3	2093	0.048	0.017	NUA_ARATH Nuclear-pore anchor OS=Arabidopsis thaliana OX=3702 GN=NUA PE=1 SV=1
20	Q93V84	2.3	33.9	331	0.038	0.085	FLXL1_ARATH Protein FLX-like 1 OS=Arabidopsis thaliana OX=3702 GN=FLXL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14362 DUF4407	44	14.8	Domain of unknown function (DUF4407)
2	PF14817 HAUS5	4.6e+02	10.9	HAUS augmin-like complex subunit 5
3	PF12795 MscS_porin	14	16.8	Mechanosensitive ion channel porin domain
4	PF03836 RasGAP_C	1.8e+02	13.7	RasGAP C-terminus
5	PF07926 TPR_MLP1_2	2.5e+02	13.1	TPR/MLP1/MLP2-like protein
6	PF17098 Wtap	9.5e+02	11.2	WTAP/Mum2p family
7	PF06156 YabA	97	15.0	Initiation control protein YabA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357448

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
2	9606.ENSP00000405330	0.768	Estrogen receptor
3	9606.ENSP00000357409	0.677	DC-STAMP domain containing 2
4	9606.ENSP00000357840	0.636	Sodium-dependent glucose transporter 1
5	9606.ENSP00000355689	0.615	Guanylate kinase
6	9606.ENSP00000380659	0.556	Eukaryotic translation initiation factor 4E transporter
7	9606.ENSP00000451545	0.556	Double homeobox 4 like 2
8	9606.ENSP00000405890	0.544	Pre-B-cell leukemia transcription factor 1
9	9606.ENSP00000356115	0.541	Major facilitator superfamily domain containing 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140297	0.997	DNA-binding transcription factor binding
GO:0003714	0.996	transcription corepressor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0006355	0.973	regulation of DNA-templated transcription
GO:0048523	0.915	negative regulation of cellular process
GO:0032502	0.867	developmental process
GO:0009892	0.834	negative regulation of metabolic process
GO:0010605	0.785	negative regulation of macromolecule metabolic process
GO:0048856	0.617	anatomical structure development
GO:0050896	0.476	response to stimulus
GO:0030154	0.470	cell differentiation
GO:0031324	0.452	negative regulation of cellular metabolic process
GO:0071840	0.446	cellular component organization or biogenesis
GO:0051253	0.419	negative regulation of RNA metabolic process
GO:0016043	0.416	cellular component organization
GO:0048468	0.372	cell development
GO:0045892	0.339	negative regulation of DNA-templated transcription
GO:0051179	0.315	localization
GO:0048518	0.312	positive regulation of biological process
GO:0048522	0.303	positive regulation of cellular process
GO:0071704	0.301	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005829	0.998	cytosol
GO:0043228	0.878	non-membrane-bounded organelle
GO:0043232	0.874	intracellular non-membrane-bounded organelle
GO:0016020	0.765	membrane
GO:0032991	0.641	protein-containing complex
GO:0043233	0.567	organelle lumen
GO:0070013	0.564	intracellular organelle lumen
GO:0031981	0.540	nuclear lumen
GO:0005654	0.319	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]