StarFunc result for job id Q96AQ8

User Input

>input (359 residues)
MDCGSVGGQRTQRLPGRQRLLFLPVGLSGRPGGSETSARRCLSALSDGLGALRPRAPAAR
GGVSRASPLLLLLLVPSPRLAAAAPRRQLGDWERSRLGYAAPPAGRSSAWRCSPGVAAAA
GALPQYHGPAPALVSCRRELSLSAGSLQLERKRRDFTSSGSRKLYFDTHALVCLLEDNGF
ATQQAEIIVSALVKILEANMDIVYKDMVTKMQQEITFQQVMSQIANVKKDMIILEKSEFS
ALRAENEKIKLELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEI
VALHAQQDRALTQTDRKIETEVAGLKTMLESHKLDNIKYLAGSIFTCLTVALGFYRLWI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96AQ8	1.000	1.000	1.652E-49	359	1.000	1.000	Q96AQ8.pdb.gz	MCUR1_HUMAN Mitochondrial calcium uniporter regulator 1 OS=Homo sapiens OX=9606 GN=MCUR1 PE=1 SV=1
2	AFDB:Q8C3X2	0.363	0.484	3.057E-15	256	0.320	0.449	Q8C3X2.pdb.gz	CC90B_MOUSE Coiled-coil domain-containing protein 90B, mitochondrial OS=Mus musculus OX=10090 GN=Ccdc90b PE=1 SV=1
3	AFDB:Q9SIV6	0.332	0.505	8.386E-7	230	0.175	0.274	Q9SIV6.pdb.gz	Q9SIV6_ARATH Coiled-coil 90B-like protein (DUF1640) OS=Arabidopsis thaliana OX=3702 GN=At2g16460 PE=1 SV=2
4	AFDB:P28739	0.198	0.107	2.715E-4	770	0.214	0.100	P28739.pdb.gz	KLPA_EMENI Kinesin-like protein klpA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=klpA PE=2 SV=3
5	AFDB:Q811D2	0.255	0.068	6.715E-4	1581	0.153	0.035	Q811D2.pdb.gz	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
6	AFDB:Q3LGD4	0.229	0.141	8.275E-4	621	0.184	0.106	Q3LGD4.pdb.gz	RFP4A_DANRE Rab11 family-interacting protein 4A OS=Danio rerio OX=7955 GN=rab11fip4a PE=2 SV=1
7	AFDB:Q6RCE1	0.123	0.078	1.347E-3	641	0.164	0.092	Q6RCE1.pdb.gz	IFT74_CHLRE Intraflagellar transport protein 74 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT74 PE=1 SV=1
8	AFDB:Q86YS3	0.292	0.186	1.347E-3	637	0.173	0.097	Q86YS3.pdb.gz	RFIP4_HUMAN Rab11 family-interacting protein 4 OS=Homo sapiens OX=9606 GN=RAB11FIP4 PE=1 SV=1
9	AFDB:F1P0K1	0.287	0.117	1.549E-3	997	0.142	0.051	F1P0K1.pdb.gz
10	AFDB:Q5TYW2	0.255	0.126	3.107E-3	823	0.164	0.072	Q5TYW2.pdb.gz	A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens OX=9606 GN=ANKRD20A1 PE=2 SV=1
11	PDB:1y11A	0.094	0.093	1.834	364	0.025	0.025	1y11A.pdb.gz
12	PDB:6ypcW	0.095	0.360	2.260	69	0.031	0.159	6ypcW.pdb.gz
13	PDB:1tj7A	0.083	0.067	2.423	455	0.022	0.018	1tj7A.pdb.gz	Structure determination and refinement at 2.44 A resolution of argininosuccinate lyase from Escherichia coli.
14	PDB:7edxd	0.097	0.202	2.986	158	0.042	0.095	7edxd.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
15	PDB:7edxm	0.084	0.272	2.986	87	0.025	0.103	7edxm.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
16	PDB:2ztdA	0.082	0.147	3.202	189	0.042	0.079	2ztdA.pdb.gz
17	PDB:2c5qE	0.073	0.111	3.432	233	0.019	0.030	2c5qE.pdb.gz
18	PDB:1k62B	0.088	0.069	3.680	459	0.019	0.015	1k62B.pdb.gz
19	PDB:6oifA	0.074	0.092	3.680	282	0.031	0.039	6oifA.pdb.gz	The AAA + ATPase TorsinA polymerizes into hollow helical tubes with 8.5 subunits per turn.
20	PDB:1i0aA	0.089	0.070	4.230	453	0.019	0.015	1i0aA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96AQ8	0.0	731	359	1.000	1.000	MCUR1_HUMAN Mitochondrial calcium uniporter regulator 1 OS=Homo sapiens OX=9606 GN=MCUR1 PE=1 SV=1
2	Q9GZT6	1.51e-76	238	254	0.345	0.488	CC90B_HUMAN Coiled-coil domain-containing protein 90B, mitochondrial OS=Homo sapiens OX=9606 GN=CCDC90B PE=1 SV=2
3	Q8C3X2	7.75e-74	231	256	0.334	0.469	CC90B_MOUSE Coiled-coil domain-containing protein 90B, mitochondrial OS=Mus musculus OX=10090 GN=Ccdc90b PE=1 SV=1
4	E9PKQ5	1.16e-36	133	208	0.214	0.370	E9PKQ5_HUMAN Coiled-coil domain containing 90B OS=Homo sapiens OX=9606 GN=CCDC90B PE=1 SV=1
5	Q9SIV6	5.72e-17	81.3	230	0.162	0.252	Q9SIV6_ARATH Coiled-coil 90B-like protein (DUF1640) OS=Arabidopsis thaliana OX=3702 GN=At2g16460 PE=1 SV=2
6	P43557	4.33e-11	63.9	207	0.131	0.227	FMP32_YEAST Protein FMP32, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FMP32 PE=1 SV=1
7	Q10073	2.84e-04	43.9	211	0.109	0.185	YAN8_SCHPO Uncharacterized CCDC90 family protein C3H1.08c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H1.08c PE=3 SV=1
8	O14042	0.001	42.0	216	0.109	0.181	FMP32_SCHPO Protein fmp32, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fmp32 PE=3 SV=1
9	P30835	0.18	36.2	780	0.089	0.041	PFKAL_RAT ATP-dependent 6-phosphofructokinase, liver type OS=Rattus norvegicus OX=10116 GN=Pfkl PE=1 SV=3
10	P12382	0.19	36.2	780	0.089	0.041	PFKAL_MOUSE ATP-dependent 6-phosphofructokinase, liver type OS=Mus musculus OX=10090 GN=Pfkl PE=1 SV=4
11	Q382N5	1.1	33.9	1569	0.078	0.018	Q382N5_TRYB2 Phospholipid-transporting ATPase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.52.0018 PE=4 SV=1
12	Q9JI78	2.4	32.7	651	0.081	0.045	NGLY1_MOUSE Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Mus musculus OX=10090 GN=Ngly1 PE=1 SV=2
13	Q52879	2.8	30.8	121	0.056	0.165	Q52879_RHIML CheY1 OS=Rhizobium meliloti OX=382 GN=cheY1 PE=1 SV=1
14	G5ECE3	3.1	32.3	3102	0.070	0.008	LAM3_CAEEL Laminin subunit alpha lam-3 OS=Caenorhabditis elegans OX=6239 GN=lam-3 PE=1 SV=1
15	G5EGK6	4.1	32.0	2407	0.067	0.010	DIN1_CAEEL Daf-12-interacting protein 1 OS=Caenorhabditis elegans OX=6239 GN=din-1 PE=1 SV=1
16	P15215	4.5	32.0	1639	0.056	0.012	LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster OX=7227 GN=LanB2 PE=2 SV=2
17	A9ZLL8	7.0	31.2	756	0.081	0.038	LSD90_SCHPO Protein lsd90 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsd90 PE=1 SV=1
18	Q7JYZ9	7.1	30.8	221	0.081	0.131	Q7JYZ9_DROME Glutathione S transferase E2 OS=Drosophila melanogaster OX=7227 GN=GstE2 PE=2 SV=1
19	P25386	7.2	31.2	1790	0.103	0.021	USO1_YEAST Intracellular protein transport protein USO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=USO1 PE=1 SV=2
20	Q9X0R4	7.4	31.2	1170	0.084	0.026	Q9X0R4_THEMA Chromosome partition protein Smc OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=smc PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07798 CCDC90-like	1e-51	186.9	Coiled-coil domain-containing protein 90-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368468

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362144	0.990	Calcium uniporter protein, mitochondrial
2	9606.ENSP00000354415	0.966	Calcium uptake protein 1, mitochondrial
3	9606.ENSP00000378145	0.965	Calcium uniporter regulatory subunit MCUb, mitochondrial
4	9606.ENSP00000371811	0.959	Calcium uptake protein 2, mitochondrial
5	9606.ENSP00000321455	0.875	Calcium uptake protein 3, mitochondrial
6	9606.ENSP00000301454	0.839	Calcium-binding mitochondrial carrier protein SCaMC-3
7	9606.ENSP00000327467	0.806	Essential MCU regulator, mitochondrial
8	9606.ENSP00000305653	0.777	Mitochondrial proton/calcium exchanger protein
9	9606.ENSP00000447091	0.716	Mitochondrial sodium/calcium exchanger protein
10	9606.ENSP00000434724	0.672	Coiled-coil domain-containing protein 90B, mitochondrial
11	9606.ENSP00000254759	0.626	Ubiquinone biosynthesis O-methyltransferase, mitochondrial
12	9606.ENSP00000400895	0.626	Otogelin-like protein
13	9606.ENSP00000225174	0.623	Peptidyl-prolyl cis-trans isomerase F, mitochondrial
14	9606.ENSP00000322649	0.561	Solute carrier family 25 member 41
15	9606.ENSP00000264093	0.503	Deoxyguanosine kinase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.317	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1990542	0.997	mitochondrial transmembrane transport
GO:0006874	0.997	intracellular calcium ion homeostasis
GO:0070588	0.996	calcium ion transmembrane transport
GO:0051560	0.993	mitochondrial calcium ion homeostasis
GO:0070509	0.918	calcium ion import
GO:0051561	0.422	positive regulation of mitochondrial calcium ion concentration
GO:0036444	0.395	calcium import into the mitochondrion
GO:0065007	0.333	biological regulation
GO:0050789	0.324	regulation of biological process
GO:0050794	0.313	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031966	0.999	mitochondrial membrane
GO:0019866	0.995	organelle inner membrane
GO:0005743	0.993	mitochondrial inner membrane
GO:0032991	0.340	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]