StarFunc result for job id Q96AV8

User Input

>input (911 residues)
MEVNCLTLKDLISPRQPRLDFAVEDGENAQKENIFVDRSRMAPKTPIKNEPIDLSKQKKF
TPERNPITPVKFVDRQQAEPWTPTANLKMLISAASPDIRDREKKKGLFRPIENKDDAFTD
SLQLDVVGDSAVDEFEKQRPSRKQKSLGLLCQKFLARYPSYPLSTEKTTISLDEVAVSLG
VERRRIYDIVNVLESLHLVSRVAKNQYGWHGRHSLPKTLRNLQRLGEEQKYEEQMAYLQQ
KELDLIDYKFGERKKDGDPDSQEQQLLDFSEPDCPSSSANSRKDKSLRIMSQKFVMLFLV
SKTKIVTLDVAAKILIEESQDAPDHSKFKTKVRRLYDIANVLTSLALIKKVHVTEERGRK
PAFKWIGPVDFSSSDEELVDVSASVLPELKRETYGQIQVCAKQKLARHGSFNTVQASERI
QRKVNSEPSSPYREEQGSGGYSLEIGSLAAVYRQKIEDNSQGKAFASKRVVPPSSSLDPV
APFPVLSVDPEYCVNPLAHPVFSVAQTDLQAFSMQNGLNGQVDVSLASAASAVESLKPAL
LAGQPLVYVPSASLFMLYGSLQEGPASGSGSERDDRSSEAPATVELSSAPSAQKRLCEER
KPQEEDEPATKRQSREYEDGPLSLVMPKKPSDSTDLASPKTMGNRASIPLKDIHVNGQLP
AAEEISGKATANSLVSSEWGNPSRNTDVEKPSKENESTKEPSLLQYLCVQSPAGLNGFNV
LLSGSQTPPTVGPSSGQLPSFSVPCMVLPSPPLGPFPVLYSPAMPGPVSSTLGALPNTGP
VNFSLPGLGSIAQLLVGPTAVVNPKSSTLPSADPQLQSQPSLNLSPVMSRSHSVVQQPES
PVYVGHPVSVVKLHQSPVPVTPKSIQRTHRETFFKTPGSLGDPVLKRRERNQSRNTSSAQ
RRLEIPSGGAD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96AV8	1.000	1.000	0.000	911	1.000	1.000	Q96AV8.pdb.gz	E2F7_HUMAN Transcription factor E2F7 OS=Homo sapiens OX=9606 GN=E2F7 PE=1 SV=3
2	AFDB:Q6S7F2	0.475	0.478	1.497E-88	904	0.791	0.798	Q6S7F2.pdb.gz	E2F7_MOUSE Transcription factor E2F7 OS=Mus musculus OX=10090 GN=E2f7 PE=1 SV=1
3	AFDB:Q5RIX9	0.269	0.333	2.074E-38	723	0.351	0.443	Q5RIX9.pdb.gz	E2F7_DANRE Transcription factor E2F7 OS=Danio rerio OX=7955 GN=e2f7 PE=1 SV=2
4	AFDB:Q58FA4	0.306	0.322	1.193E-36	860	0.336	0.356	Q58FA4.pdb.gz	E2F8_MOUSE Transcription factor E2F8 OS=Mus musculus OX=10090 GN=E2f8 PE=1 SV=1
5	AFDB:F1QZ88	0.286	0.284	1.088E-35	917	0.296	0.294	F1QZ88.pdb.gz	E2F8_DANRE Transcription factor E2F8 OS=Danio rerio OX=7955 GN=e2f8 PE=3 SV=1
6	AFDB:Q9VID4	0.054	0.048	7.450E-4	1119	0.133	0.108	Q9VID4.pdb.gz	Q9VID4_DROME LD38259p OS=Drosophila melanogaster OX=7227 GN=Mondo PE=2 SV=2
7	AFDB:Q6PAC4	0.040	0.032	1.729E-3	1279	0.147	0.105	Q6PAC4.pdb.gz	PCARE_MOUSE Photoreceptor cilium actin regulator OS=Mus musculus OX=10090 GN=Pcare PE=2 SV=1
8	AFDB:Q7Z591	0.068	0.047	2.371E-3	1439	0.180	0.114	Q7Z591.pdb.gz	AKNA_HUMAN Microtubule organization protein AKNA OS=Homo sapiens OX=9606 GN=AKNA PE=1 SV=2
9	AFDB:P47068	0.040	0.035	4.230E-3	1157	0.142	0.111	P47068.pdb.gz	BBC1_YEAST Myosin tail region-interacting protein MTI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BBC1 PE=1 SV=2
10	AFDB:O08696	0.080	0.093	4.459E-3	760	0.153	0.183	O08696.pdb.gz	FOXM1_MOUSE Forkhead box protein M1 OS=Mus musculus OX=10090 GN=Foxm1 PE=1 SV=2
11	PDB:5afqB	0.073	0.137	9.444E-3	444	0.026	0.054	5afqB.pdb.gz	Structural Analysis of Human Rpc32Beta - Rpc62 Complex.
12	PDB:7a6hO	0.066	0.108	2.705E-2	512	0.029	0.051	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
13	PDB:2xv4S	0.079	0.154	3.710E-2	399	0.023	0.053	2xv4S.pdb.gz
14	PDB:7d58O	0.068	0.116	7.750E-2	490	0.033	0.061	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
15	PDB:7dn3O	0.076	0.142	9.566E-2	443	0.034	0.070	7dn3O.pdb.gz	Structure of human RNA polymerase III elongation complex.
16	PDB:5xohA	0.068	0.162	1.181E-1	348	0.011	0.029	5xohA.pdb.gz	Crystal structure of bergaptol o-methyltransferase complex
17	PDB:4ev0D	0.063	0.219	1.383E-1	214	0.025	0.107	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein
18	PDB:7z1mO	0.068	0.097	1.536E-1	570	0.029	0.046	7z1mO.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
19	PDB:1fp1D	0.056	0.145	3.382E-1	340	0.011	0.029	1fp1D.pdb.gz	Structures of two natural product methyltransferases reveal the basis for substrate specificity in plant O-methyltransferases.
20	PDB:1ft9A	0.071	0.258	3.961E-1	210	0.013	0.057	1ft9A.pdb.gz	Structure of the CO sensing transcription activator CooA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8VSE7	0.0	1412	693	0.761	1.000	F8VSE7_HUMAN E2F transcription factor 7 (Fragment) OS=Homo sapiens OX=9606 GN=E2F7 PE=1 SV=1
2	Q6S7F2	0.0	1427	904	0.793	0.799	E2F7_MOUSE Transcription factor E2F7 OS=Mus musculus OX=10090 GN=E2f7 PE=1 SV=1
3	Q96AV8	0.0	1848	911	1.000	1.000	E2F7_HUMAN Transcription factor E2F7 OS=Homo sapiens OX=9606 GN=E2F7 PE=1 SV=3
4	Q5RIX9	3.43e-126	399	723	0.263	0.332	E2F7_DANRE Transcription factor E2F7 OS=Danio rerio OX=7955 GN=e2f7 PE=1 SV=2
5	A0AVK6	4.41e-115	374	867	0.257	0.270	E2F8_HUMAN Transcription factor E2F8 OS=Homo sapiens OX=9606 GN=E2F8 PE=1 SV=1
6	Q58FA4	1.02e-108	357	860	0.283	0.300	E2F8_MOUSE Transcription factor E2F8 OS=Mus musculus OX=10090 GN=E2f8 PE=1 SV=1
7	F1QZ88	9.98e-106	350	917	0.357	0.354	E2F8_DANRE Transcription factor E2F8 OS=Danio rerio OX=7955 GN=e2f8 PE=3 SV=1
8	F8VXV5	9.21e-74	239	115	0.126	1.000	F8VXV5_HUMAN E2F transcription factor 7 (Fragment) OS=Homo sapiens OX=9606 GN=E2F7 PE=1 SV=1
9	Q9LFQ9	1.25e-44	167	359	0.124	0.315	E2FD_ARATH E2F transcription factor-like E2FD OS=Arabidopsis thaliana OX=3702 GN=E2FD PE=1 SV=1
10	Q8LSZ4	8.13e-43	163	403	0.147	0.333	E2FE_ARATH E2F transcription factor-like E2FE OS=Arabidopsis thaliana OX=3702 GN=E2FE PE=1 SV=1
11	Q8RWL0	3.12e-42	160	354	0.106	0.274	E2FF_ARATH E2F transcription factor-like E2FF OS=Arabidopsis thaliana OX=3702 GN=E2FF PE=2 SV=1
12	Q20619	1.20e-29	127	600	0.106	0.162	EFL3_CAEEL Transcription factor efl-3 OS=Caenorhabditis elegans OX=6239 GN=efl-3 PE=2 SV=2
13	Q14209	2.18e-09	63.2	437	0.043	0.089	E2F2_HUMAN Transcription factor E2F2 OS=Homo sapiens OX=9606 GN=E2F2 PE=1 SV=1
14	P56931	5.95e-09	61.6	443	0.042	0.086	E2F2_MOUSE Transcription factor E2F2 OS=Mus musculus OX=10090 GN=E2f2 PE=1 SV=2
15	Q9FV70	3.51e-08	58.9	396	0.034	0.078	E2FC_ARATH Transcription factor E2FC OS=Arabidopsis thaliana OX=3702 GN=E2FC PE=1 SV=1
16	O35261	3.80e-08	59.3	457	0.032	0.063	E2F3_MOUSE Transcription factor E2F3 OS=Mus musculus OX=10090 GN=E2f3 PE=1 SV=2
17	Q6DE14	4.00e-08	58.9	375	0.044	0.107	E2F4_XENLA Transcription factor E2F4 OS=Xenopus laevis OX=8355 GN=e2f4 PE=1 SV=1
18	O00716	4.12e-08	59.3	465	0.032	0.062	E2F3_HUMAN Transcription factor E2F3 OS=Homo sapiens OX=9606 GN=E2F3 PE=1 SV=1
19	Q15329	1.14e-07	57.4	346	0.044	0.116	E2F5_HUMAN Transcription factor E2F5 OS=Homo sapiens OX=9606 GN=E2F5 PE=1 SV=1
20	Q9FNY0	1.15e-07	57.8	485	0.046	0.087	E2FA_ARATH Transcription factor E2FA OS=Arabidopsis thaliana OX=3702 GN=E2FA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04182 B-block_TFIIIC	1.2e+02	14.2	B-block binding subunit of TFIIIC
2	PF02319 E2F_TDP	3e-40	147.3	E2F/DP family winged-helix DNA-binding domain
3	PF05373 Pro_3_hydrox_C	2.9e+02	13.0	L-proline 3-hydroxylase, C-terminal
4	PF01978 TrmB	19	16.6	Sugar-specific transcriptional regulator TrmB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323246

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.969	Cellular tumor antigen p53
2	9606.ENSP00000345571	0.953	Transcription factor E2F1
3	9606.ENSP00000481103	0.933	Transcription factor E2F8
4	9606.ENSP00000274026	0.885	Cyclin-A2
5	9606.ENSP00000362768	0.867	Retinoblastoma-like protein 1
6	9606.ENSP00000209728	0.856	Cell division control protein 6 homolog
7	9606.ENSP00000267163	0.848	Retinoblastoma-associated protein
8	9606.ENSP00000378699	0.807	Cyclin-dependent kinase 1
9	9606.ENSP00000385461	0.788	Transcription factor Dp family member 3
10	9606.ENSP00000266970	0.784	Cyclin-dependent kinase 2
11	9606.ENSP00000257904	0.759	Cyclin-dependent kinase 4
12	9606.ENSP00000362146	0.758	Borealin
13	9606.ENSP00000265734	0.735	Cyclin-dependent kinase 6
14	9606.ENSP00000256442	0.729	G2/mitotic-specific cyclin-B1
15	9606.ENSP00000262133	0.719	Retinoblastoma-like protein 2
16	9606.ENSP00000227507	0.715	G1/S-specific cyclin-D1
17	9606.ENSP00000217026	0.712	Myb-related protein B
18	9606.ENSP00000247191	0.708	Disks large-associated protein 5
19	9606.ENSP00000302530	0.704	Mitotic checkpoint serine/threonine-protein kinase BUB1
20	9606.ENSP00000353770	0.701	Ribonucleoside-diphosphate reductase subunit M2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000987	1.000	cis-regulatory region sequence-specific DNA binding
GO:0042802	0.949	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0019222	0.987	regulation of metabolic process
GO:0009987	0.985	cellular process
GO:0010468	0.984	regulation of gene expression
GO:0010556	0.984	regulation of macromolecule biosynthetic process
GO:0031326	0.982	regulation of cellular biosynthetic process
GO:0051172	0.980	negative regulation of nitrogen compound metabolic process
GO:0051252	0.978	regulation of RNA metabolic process
GO:0007049	0.977	cell cycle
GO:0006355	0.974	regulation of DNA-templated transcription
GO:0010558	0.973	negative regulation of macromolecule biosynthetic process
GO:0031327	0.973	negative regulation of cellular biosynthetic process
GO:0051253	0.971	negative regulation of RNA metabolic process
GO:0035295	0.966	tube development
GO:0048646	0.965	anatomical structure formation involved in morphogenesis
GO:0001525	0.964	angiogenesis
GO:0022402	0.961	cell cycle process
GO:0048522	0.961	positive regulation of cellular process
GO:0000278	0.957	mitotic cell cycle
GO:1903047	0.954	mitotic cell cycle process
GO:0051173	0.953	positive regulation of nitrogen compound metabolic process
GO:0010604	0.950	positive regulation of macromolecule metabolic process
GO:0045892	0.948	negative regulation of DNA-templated transcription
GO:0031325	0.945	positive regulation of cellular metabolic process
GO:0006357	0.940	regulation of transcription by RNA polymerase II
GO:0050896	0.931	response to stimulus
GO:0002040	0.931	sprouting angiogenesis
GO:0045935	0.904	positive regulation of nucleobase-containing compound metabolic process
GO:0051716	0.869	cellular response to stimulus
GO:0000122	0.869	negative regulation of transcription by RNA polymerase II
GO:0045944	0.784	positive regulation of transcription by RNA polymerase II
GO:0044770	0.776	cell cycle phase transition
GO:0007154	0.741	cell communication
GO:0042127	0.705	regulation of cell population proliferation
GO:0044772	0.694	mitotic cell cycle phase transition
GO:0023052	0.651	signaling
GO:0033554	0.643	cellular response to stress
GO:0007165	0.619	signal transduction
GO:0035556	0.521	intracellular signal transduction
GO:0008285	0.478	negative regulation of cell population proliferation
GO:0051726	0.473	regulation of cell cycle
GO:0010564	0.454	regulation of cell cycle process
GO:0006974	0.421	cellular response to DNA damage stimulus
GO:0044843	0.406	cell cycle G1/S phase transition
GO:0000082	0.384	G1/S transition of mitotic cell cycle
GO:1901987	0.363	regulation of cell cycle phase transition
GO:0007346	0.318	regulation of mitotic cell cycle
GO:0072331	0.301	signal transduction by p53 class mediator

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.916	intracellular non-membrane-bounded organelle
GO:0016604	0.805	nuclear body
GO:0005737	0.779	cytoplasm
GO:0005829	0.464	cytosol
GO:0016607	0.461	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]