StarFunc result for job id Q96AX1

User Input

>input (596 residues)
MAAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEV
EKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLL
CEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLM
TLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPL
ATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEELYAEIR
DKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAEL
IKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGL
KQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQ
NPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPG
ENRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9D2N9	0.989	0.986	5.584E-103	598	0.977	0.973	Q9D2N9.pdb.gz	VP33A_MOUSE Vacuolar protein sorting-associated protein 33A OS=Mus musculus OX=10090 GN=Vps33a PE=1 SV=2
2	PDB:4bx9B	0.958	0.983	6.119E-95	581	0.970	0.995	4bx9B.pdb.gz
3	AFDB:A4V4S5	0.946	0.914	9.439E-62	617	0.448	0.433	A4V4S5.pdb.gz	A4V4S5_DROME Carnation, isoform B OS=Drosophila melanogaster OX=7227 GN=car PE=1 SV=1
4	AFDB:F4JE40	0.897	0.880	5.369E-55	608	0.372	0.365	F4JE40.pdb.gz	F4JE40_ARATH Sec1/munc18-like (SM) proteins superfamily OS=Arabidopsis thaliana OX=3702 GN=ATVPS33 PE=1 SV=1
5	AFDB:G0SCM5	0.891	0.665	6.197E-52	806	0.386	0.285	G0SCM5.pdb.gz	G0SCM5_CHATD Small conjugating protein ligase-like protein OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0057760 PE=1 SV=1
6	AFDB:Q58EN8	0.896	0.866	1.639E-48	617	0.324	0.313	Q58EN8.pdb.gz	VP33B_DANRE Vacuolar protein sorting-associated protein 33B OS=Danio rerio OX=7955 GN=vps33b PE=2 SV=1
7	AFDB:P59016	0.900	0.870	2.080E-47	617	0.327	0.316	P59016.pdb.gz	VP33B_MOUSE Vacuolar protein sorting-associated protein 33B OS=Mus musculus OX=10090 GN=Vps33b PE=1 SV=1
8	AFDB:Q9P7V6	0.871	0.877	1.743E-46	592	0.329	0.331	Q9P7V6.pdb.gz	VPS33_SCHPO Vacuolar protein sorting-associated protein 33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps33 PE=3 SV=1
9	AFDB:P34260	0.801	0.792	4.653E-41	603	0.257	0.254	P34260.pdb.gz	VP33A_CAEEL Vacuolar protein sorting-associated protein 33A OS=Caenorhabditis elegans OX=6239 GN=vps-33.1 PE=1 SV=4
10	AFDB:Q18891	0.848	0.820	2.157E-39	617	0.237	0.229	Q18891.pdb.gz	VP33B_CAEEL Vacuolar protein sorting-associated protein 33B OS=Caenorhabditis elegans OX=6239 GN=vps-33.2 PE=1 SV=3
11	AFDB:Q9VBR1	0.805	0.753	3.646E-32	640	0.211	0.197	Q9VBR1.pdb.gz	Q9VBR1_DROME Vacuolar protein sorting 33B OS=Drosophila melanogaster OX=7227 GN=Vps33B PE=3 SV=1
12	PDB:4ccaA	0.608	0.658	9.354E-25	542	0.149	0.164	4ccaA.pdb.gz
13	PDB:7zu0D	0.681	0.680	3.276E-22	597	0.216	0.216	7zu0D.pdb.gz
14	PDB:7xsjA	0.595	0.625	3.634E-22	561	0.158	0.168	7xsjA.pdb.gz	A non-canonical target-binding site in Munc18-1 domain 3b for assembling the Mint1-Munc18-1-syntaxin-1 complex.
15	PDB:3pukA	0.598	0.635	6.104E-22	552	0.168	0.181	3pukA.pdb.gz	Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation
16	PDB:3pujB	0.569	0.620	6.771E-22	534	0.158	0.176	3pujB.pdb.gz	Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation
17	PDB:1mqsA	0.552	0.558	6.351E-19	588	0.174	0.177	1mqsA.pdb.gz	Structural basis for the Golgi membrane recruitment of Sly1p by Sed5p
18	PDB:6lpcB	0.504	0.625	2.490E-14	467	0.141	0.180	6lpcB.pdb.gz
19	PDB:1qo0E	0.132	0.345	7.045E-2	194	0.037	0.113	1qo0E.pdb.gz	Crystal Structure and Induction Mechanism of Amic-Amir: A Ligand-Regulated Transcription Antitermination Complex
20	PDB:4xgtA	0.137	0.096	7.420E-2	961	0.124	0.077	4xgtA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RDH6	0.0	1228	596	0.998	0.998	B2RDH6_HUMAN cDNA, FLJ96613, highly similar to Homo sapiens vacuolar protein sorting 33A (yeast) (VPS33A), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q63615	0.0	1198	597	0.970	0.968	VP33A_RAT Vacuolar protein sorting-associated protein 33A OS=Rattus norvegicus OX=10116 GN=Vps33a PE=1 SV=1
3	Q96AX1	0.0	1231	596	1.000	1.000	VP33A_HUMAN Vacuolar protein sorting-associated protein 33A OS=Homo sapiens OX=9606 GN=VPS33A PE=1 SV=1
4	Q9D2N9	0.0	1205	598	0.978	0.975	VP33A_MOUSE Vacuolar protein sorting-associated protein 33A OS=Mus musculus OX=10090 GN=Vps33a PE=1 SV=2
5	Q9H6C4	0.0	528	253	0.424	1.000	Q9H6C4_HUMAN cDNA: FLJ22395 fis, clone HRC07889 OS=Homo sapiens OX=9606 PE=2 SV=1
6	A4V4S5	2.23e-157	466	617	0.443	0.428	A4V4S5_DROME Carnation, isoform B OS=Drosophila melanogaster OX=7227 GN=car PE=1 SV=1
7	Q9Y1I2	2.23e-157	466	617	0.443	0.428	VP33A_DROME Vacuolar protein sorting-associated protein 33A OS=Drosophila melanogaster OX=7227 GN=car PE=1 SV=1
8	M9PF72	4.59e-157	466	639	0.443	0.413	M9PF72_DROME Carnation, isoform C OS=Drosophila melanogaster OX=7227 GN=car PE=1 SV=1
9	Q94KJ7	1.26e-132	402	592	0.379	0.382	VPS33_ARATH Vacuolar protein-sorting-associated protein 33 homolog OS=Arabidopsis thaliana OX=3702 GN=VPS33 PE=1 SV=1
10	F4JE40	2.46e-128	391	608	0.378	0.370	F4JE40_ARATH Sec1/munc18-like (SM) proteins superfamily OS=Arabidopsis thaliana OX=3702 GN=ATVPS33 PE=1 SV=1
11	G0SCM5	5.52e-125	389	806	0.389	0.288	G0SCM5_CHATD Small conjugating protein ligase-like protein OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0057760 PE=1 SV=1
12	Q58EN8	1.17e-94	304	617	0.326	0.314	VP33B_DANRE Vacuolar protein sorting-associated protein 33B OS=Danio rerio OX=7955 GN=vps33b PE=2 SV=1
13	Q63616	9.62e-92	296	617	0.331	0.319	VP33B_RAT Vacuolar protein sorting-associated protein 33B OS=Rattus norvegicus OX=10116 GN=Vps33b PE=2 SV=1
14	Q9H267	3.46e-91	295	617	0.331	0.319	VP33B_HUMAN Vacuolar protein sorting-associated protein 33B OS=Homo sapiens OX=9606 GN=VPS33B PE=1 SV=2
15	P59016	6.19e-91	295	617	0.329	0.318	VP33B_MOUSE Vacuolar protein sorting-associated protein 33B OS=Mus musculus OX=10090 GN=Vps33b PE=1 SV=1
16	Q9P7V6	2.23e-88	287	592	0.331	0.333	VPS33_SCHPO Vacuolar protein sorting-associated protein 33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps33 PE=3 SV=1
17	P34260	1.16e-47	178	603	0.272	0.269	VP33A_CAEEL Vacuolar protein sorting-associated protein 33A OS=Caenorhabditis elegans OX=6239 GN=vps-33.1 PE=1 SV=4
18	Q18891	1.55e-42	164	617	0.248	0.240	VP33B_CAEEL Vacuolar protein sorting-associated protein 33B OS=Caenorhabditis elegans OX=6239 GN=vps-33.2 PE=1 SV=3
19	P20795	1.07e-35	144	691	0.205	0.177	VPS33_YEAST Vacuolar protein sorting-associated protein 33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS33 PE=1 SV=1
20	Q9VBR1	1.48e-17	88.6	640	0.230	0.214	Q9VBR1_DROME Vacuolar protein sorting 33B OS=Drosophila melanogaster OX=7227 GN=Vps33B PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07791 DUF1629	31	16.1	Protein of unknown function (DUF1629)
2	PF01095 Pectinesterase	2.2e+02	11.9	Pectinesterase
3	PF00995 Sec1	8e-121	416.7	Sec1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267199

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220509	0.999	Vacuolar protein sorting-associated protein 18 homolog
2	9606.ENSP00000309457	0.999	Vacuolar protein sorting-associated protein 41 homolog
3	9606.ENSP00000335193	0.999	Vam6/Vps39-like protein
4	9606.ENSP00000369810	0.999	Vacuolar protein sorting-associated protein 16 homolog
5	9606.ENSP00000481126	0.999	Vacuolar protein sorting-associated protein 11 homolog
6	9606.ENSP00000404704	0.995	Vacuolar protein sorting-associated protein 8 homolog
7	9606.ENSP00000363054	0.991	Syntaxin-12
8	9606.ENSP00000265062	0.988	Ras-related protein Rab-7a
9	9606.ENSP00000376792	0.975	Vesicle transport through interaction with t-SNAREs homolog 1A
10	9606.ENSP00000223369	0.974	Synaptobrevin homolog YKT6
11	9606.ENSP00000377027	0.960	Transforming growth factor-beta receptor-associated protein 1
12	9606.ENSP00000259400	0.953	Syntaxin-17
13	9606.ENSP00000452181	0.953	Spermatogenesis-defective protein 39 homolog
14	9606.ENSP00000327650	0.949	Vacuolar protein sorting-associated protein 33B
15	9606.ENSP00000356918	0.875	Syntaxin-7
16	9606.ENSP00000479762	0.872	Ras-related protein Rab-7b
17	9606.ENSP00000305255	0.868	Syntaxin-8
18	9606.ENSP00000273047	0.817	Ras-related protein Rab-5A
19	9606.ENSP00000450731	0.809	Vesicle transport through interaction with t-SNAREs homolog 1B
20	9606.ENSP00000262640	0.796	Vesicle-associated membrane protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0051179	0.976	localization
GO:0051234	0.970	establishment of localization
GO:0006810	0.952	transport
GO:0065007	0.947	biological regulation
GO:0071840	0.886	cellular component organization or biogenesis
GO:0016043	0.875	cellular component organization
GO:0016192	0.804	vesicle-mediated transport
GO:0051641	0.668	cellular localization
GO:0006996	0.639	organelle organization
GO:0050789	0.629	regulation of biological process
GO:0051649	0.594	establishment of localization in cell
GO:0050794	0.558	regulation of cellular process
GO:0008152	0.475	metabolic process
GO:0046907	0.440	intracellular transport
GO:0044237	0.328	cellular metabolic process
GO:0043473	0.320	pigmentation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0031410	1.000	cytoplasmic vesicle
GO:0012505	0.999	endomembrane system
GO:0031090	0.993	organelle membrane
GO:0032991	0.992	protein-containing complex
GO:0005764	0.986	lysosome
GO:0098588	0.957	bounding membrane of organelle
GO:0005774	0.898	vacuolar membrane
GO:0005768	0.887	endosome
GO:0099023	0.858	vesicle tethering complex
GO:0012506	0.849	vesicle membrane
GO:0030659	0.839	cytoplasmic vesicle membrane
GO:0005829	0.777	cytosol
GO:0098796	0.636	membrane protein complex
GO:0010008	0.545	endosome membrane
GO:0098852	0.530	lytic vacuole membrane
GO:0005765	0.493	lysosomal membrane
GO:0005770	0.470	late endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]