StarFunc result for job id Q96AX9

User Input

>input (1013 residues)
MGWKPSEARGQSQSFQASGLQPRSLKAARRATGRPDRSRAARPTMDPSAHRSRAAPPNMD
PDPQAGVQVGMRVVRGVDWKWGQQDGGEGGVGTVVELGRHGSPSTPDRTVVVQWDQGTRT
NYRAGYQGAHDLLLYDNAQIGVRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHN
KHELAHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQGAKVVRGPDWEWGSQDGGEGKPG
RVVDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYKDHLPRLGK
PAELQRRVSADSQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDR
GDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALG
RVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDK
LRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKNQGRTALQVAAYLGQVELIR
LLLQARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRG
FLEVVRALCERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFT
LLHHASLKGHALAVRKILARARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVN
VRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGA
GGDPGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEGRV
LKALQGCAQRFRERQAGGGAAPGPRQTLGTPNTVTNLHVGAAPGPEAAECLVCSELALLV
LFSPCQHRTVCEECARRMKKCIRCQVVVSKKLRPDGSEVASAAPAPGPPRQLVEELQSRY
RQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0AR23	0.642	0.650	0.000	999	0.607	0.616	A0AR23.pdb.gz	A0AR23_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=mib2 PE=2 SV=1
2	AFDB:Q8R516	0.763	0.792	0.000	973	0.876	0.912	Q8R516.pdb.gz	MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus OX=10090 GN=Mib2 PE=1 SV=2
3	AFDB:Q9VJ14	0.472	0.458	8.135E-93	1049	0.416	0.401	Q9VJ14.pdb.gz	Q9VJ14_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=mib2 PE=1 SV=1
4	AFDB:D3ZUV2	0.345	0.348	2.876E-83	1006	0.374	0.377	D3ZUV2.pdb.gz	D3ZUV2_RAT RING-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Mib1 PE=4 SV=3
5	AFDB:Q804S5	0.332	0.327	3.016E-83	1030	0.372	0.366	Q804S5.pdb.gz	MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX=7955 GN=mib1 PE=1 SV=1
6	AFDB:A0A0G2KXP0	0.371	0.420	3.918E-82	889	0.475	0.541	A0A0G2KXP0.pdb.gz
7	AFDB:Q9VUX2	0.336	0.281	1.014E-79	1226	0.378	0.312	Q9VUX2.pdb.gz	MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster OX=7227 GN=mib1 PE=1 SV=3
8	AFDB:Q9ERK0	0.268	0.337	7.678E-19	786	0.113	0.145	Q9ERK0.pdb.gz	RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Ripk4 PE=1 SV=2
9	AFDB:Q9ULH0	0.276	0.165	1.294E-18	1771	0.101	0.058	Q9ULH0.pdb.gz	KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220 PE=1 SV=3
10	AFDB:Q9ULJ7	0.181	0.141	1.493E-18	1429	0.123	0.087	Q9ULJ7.pdb.gz	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
11	PDB:8cs9A	0.278	0.348	2.942E-17	796	0.101	0.128	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:5vkqA	0.218	0.156	1.833E-13	1499	0.106	0.071	5vkqA.pdb.gz
13	PDB:4oauC	0.208	0.283	4.211E-12	692	0.083	0.121	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:2dvwA	0.125	0.496	5.736E-11	229	0.061	0.271	2dvwA.pdb.gz
15	PDB:6aunA	0.196	0.300	1.483E-10	618	0.073	0.120	6aunA.pdb.gz
16	PDB:6v9hC	0.166	0.492	3.406E-9	270	0.054	0.204	6v9hC.pdb.gz
17	PDB:1wg0A	0.194	0.708	4.118E-9	243	0.057	0.239	1wg0A.pdb.gz
18	PDB:6jd6B	0.144	0.708	1.172E-6	192	0.039	0.208	6jd6B.pdb.gz
19	PDB:1bu9A	0.143	0.794	1.558E-6	168	0.048	0.292	1bu9A.pdb.gz
20	PDB:6pqpA	0.194	0.310	2.278E-6	615	0.057	0.094	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0AR23	0.0	1291	999	0.608	0.617	A0AR23_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=mib2 PE=2 SV=1
2	D3ZUV2	0.0	670	1006	0.387	0.390	D3ZUV2_RAT RING-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Mib1 PE=4 SV=3
3	Q804S5	0.0	657	1030	0.381	0.375	MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX=7955 GN=mib1 PE=1 SV=1
4	Q80SY4	0.0	672	1006	0.390	0.393	MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus OX=10090 GN=Mib1 PE=1 SV=1
5	Q86YT6	0.0	671	1006	0.388	0.391	MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens OX=9606 GN=MIB1 PE=1 SV=1
6	Q8R516	0.0	1776	973	0.877	0.913	MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus OX=10090 GN=Mib2 PE=1 SV=2
7	Q96AX9	0.0	1946	955	0.943	1.000	MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens OX=9606 GN=MIB2 PE=1 SV=4
8	Q9VJ14	0.0	759	1049	0.422	0.407	Q9VJ14_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=mib2 PE=1 SV=1
9	Q9VUX2	0.0	592	1226	0.364	0.301	MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster OX=7227 GN=mib1 PE=1 SV=3
10	A0A5F9ZHE2	1.16e-32	140	1806	0.115	0.065	A0A5F9ZHE2_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
11	A0A5F9ZHN0	1.31e-32	140	1777	0.115	0.066	A0A5F9ZHN0_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
12	A0A5F9ZHT4	1.32e-32	140	3870	0.108	0.028	A0A5F9ZHT4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
13	A0A5F9ZHF7	1.39e-32	140	3862	0.108	0.028	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
14	A0A5F9ZH17	1.42e-32	140	1879	0.115	0.062	A0A5F9ZH17_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
15	A0A5F9ZI46	1.43e-32	140	3882	0.108	0.028	A0A5F9ZI46_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
16	A0A5F9ZI36	1.50e-32	139	1846	0.115	0.063	A0A5F9ZI36_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A5F9ZI08	1.53e-32	139	1797	0.115	0.065	A0A5F9ZI08_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A5F9ZHT8	1.54e-32	140	3891	0.108	0.028	A0A5F9ZHT8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	A0A5F9ZH03	1.55e-32	139	1785	0.115	0.066	A0A5F9ZH03_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZHQ3	1.56e-32	139	1838	0.115	0.064	A0A5F9ZHQ3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3.4e-27	104.9	Ankyrin repeat
2	PF12796 Ank_2	2.7e-36	135.3	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.3e-25	97.5	Ankyrin repeat
4	PF13637 Ank_4	3e-33	125.0	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.5e-36	135.2	Ankyrin repeats (many copies)
6	PF06701 MIB_HERC2	1.7e-45	164.2	Mib_herc2
7	PF01957 NfeD	52	15.7	NfeD-like C-terminal, partner-binding
8	PF18346 SH3_15	1.7e-35	132.5	Mind bomb SH3 repeat domain
9	PF13923 zf-C3HC4_2	15	16.8	Zinc finger, C3HC4 type (RING finger)
10	PF13920 zf-C3HC4_3	1.5e-07	42.5	Zinc finger, C3HC4 type (RING finger)
11	PF00569 ZZ	0.00024	32.2	Zinc finger, ZZ type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000426103

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328169	0.974	Protein jagged-2
2	9606.ENSP00000254958	0.943	Protein jagged-1
3	9606.ENSP00000355718	0.943	Delta-like protein 1
4	9606.ENSP00000277541	0.937	Neurogenic locus notch homolog protein 1
5	9606.ENSP00000249749	0.936	Delta-like protein 4
6	9606.ENSP00000359612	0.932	B-cell lymphoma/leukemia 10
7	9606.ENSP00000256646	0.931	Neurogenic locus notch homolog protein 2
8	9606.ENSP00000263388	0.930	Neurogenic locus notch homolog protein 3
9	9606.ENSP00000358795	0.926	E3 ubiquitin-protein ligase NEURL1
10	9606.ENSP00000358815	0.924	E3 ubiquitin-protein ligase NEURL1B
11	9606.ENSP00000392025	0.833	Ubiquitin carboxyl-terminal hydrolase CYLD
12	9606.ENSP00000329967	0.739	Serine/threonine-protein kinase TBK1
13	9606.ENSP00000320485	0.729	AT-rich interactive domain-containing protein 1A
14	9606.ENSP00000381717	0.709	Ubiquitin-conjugating enzyme E2 D2
15	9606.ENSP00000272317	0.704	Ubiquitin-40S ribosomal protein S27a
16	9606.ENSP00000441543	0.703	Polyubiquitin-C
17	9606.ENSP00000304697	0.698	Polyubiquitin-B
18	9606.ENSP00000355645	0.671	Actin, alpha skeletal muscle
19	9606.ENSP00000388107	0.655	Ubiquitin-60S ribosomal protein L40
20	9606.ENSP00000401980	0.589	Mitochondrial antiviral-signaling protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	0.999	ubiquitin-protein transferase activity
GO:0061630	0.967	ubiquitin protein ligase activity
GO:0042802	0.745	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0048518	0.988	positive regulation of biological process
GO:0009987	0.956	cellular process
GO:0008152	0.945	metabolic process
GO:0070647	0.931	protein modification by small protein conjugation or removal
GO:0023051	0.906	regulation of signaling
GO:0010646	0.887	regulation of cell communication
GO:0048583	0.864	regulation of response to stimulus
GO:0009966	0.828	regulation of signal transduction
GO:0048522	0.824	positive regulation of cellular process
GO:0009967	0.733	positive regulation of signal transduction
GO:0032446	0.688	protein modification by small protein conjugation
GO:1902531	0.649	regulation of intracellular signal transduction
GO:0016567	0.602	protein ubiquitination
GO:0019222	0.600	regulation of metabolic process
GO:0060255	0.530	regulation of macromolecule metabolic process
GO:0080090	0.413	regulation of primary metabolic process
GO:0051171	0.411	regulation of nitrogen compound metabolic process
GO:0050896	0.401	response to stimulus
GO:0009893	0.396	positive regulation of metabolic process
GO:0010604	0.392	positive regulation of macromolecule metabolic process
GO:0048519	0.384	negative regulation of biological process
GO:0048523	0.340	negative regulation of cellular process
GO:0043122	0.335	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043123	0.322	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0044237	0.306	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.998	cytosol
GO:0012505	0.983	endomembrane system
GO:0032991	0.976	protein-containing complex
GO:0016020	0.877	membrane
GO:0031982	0.860	vesicle
GO:0031410	0.672	cytoplasmic vesicle
GO:0140535	0.652	intracellular protein-containing complex
GO:0043232	0.647	intracellular non-membrane-bounded organelle
GO:1990234	0.619	transferase complex
GO:0000151	0.538	ubiquitin ligase complex
GO:0005634	0.432	nucleus
GO:0043233	0.351	organelle lumen
GO:0070013	0.337	intracellular organelle lumen
GO:0005768	0.312	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.

[back to server]