StarFunc result for job id Q96AY4

User Input

>input (2481 residues)
MEQSPPPAPEPTQGPTPARSRRRREPESPPASAPIPLFGADTIGQRSPDGPVLSKAEFVE
KVRQSNQACHDGDFHTAIVLYNEALAVDPQNCILYSNRSAAYMKIQQYDKALDDAIKARL
LNPKWPKAYFRQGVALQYLGRHADALAAFASGLAQDPKSLQLLVGMVEAAMKSPMRDSLE
PTYQQLQKMKLDKSPFVVVSVVGQELLTAGHHGASVVVLEAALKIGTCSLKLRGSVFSAL
SSAYWSLGNTEKSTGYMQQDLDVAKTLGDQTGECRAHGNLGSAFFSKGNYREALTNHRHQ
LVLAMKLKDREAASSALSSLGHVYTAIGDYPNALASHKQCVLLAKQSKDELSEARELGNM
GAVYIAMGDFENAVQCHEQHLKIAKDLGNKREEARAYSNLGSAYHYRRNFDKAMSYHNYV
LELAQELMEKAIEMRAYAGLGHAARCMQDLERAKQYHEQQLGIAEDLKDRAAEGRASSNL
GIIHQMKGDYDTALKLHKTHLCIAQELSDYAAQGRAYGNMGNAYNALGMYDQAVKYHRQE
LQISMEVNDRASQASTHGNLAVAYQALGAHDRALQHYQNHLNIARELRDIQSEARALSNL
GNFHCSRGEYVQAAPYYEQYLRLAPDLQDMEGEGKVCHNLGYAHYCLGNYQEAVKYYEQD
LALAKDLHDKLSQAKAYCNLGLAFKALLNFSKAEECQKYLLSLAQSLNNSQAKFRALGNL
GDIFICKKDINGAIKFYEQQLGLAHQVKDRRLEASAYAALGTAYRMIQKYDKALGYHTQE
LEVYQELSDLPGECRAHGHLAAVYMALGKYTMAFKCYEEQLDLGQKLKDPSLEAQVYGNM
GITKMNMNVMEEAIGYFEQQLAMLQQLSGNESVLDRGRAYGNLGDCYEALGDYEEAIKYY
EQYLSVAQSLNRMQDQAKAYRGLGNGHRAMGSLQQALVCFEKRLVVAHELGEAFNKAQAY
GELGSLHSQLGNYEQAISCLERQLNIARDMKDRALESDAACGLGGVYQQMGEYDTALQYH
QLDLQIAEETNNPTCQGRAYGNLGLTYESLGTFERAVVYQEQHLSIAAQMNDLAAKTVSY
SSLGRTHHALQNYSQAVMYLQEGLRLAEQLGRREDEAKIRHGLGLSLWASGNLEEAQHQL
YRASALFETIRHEAQLSTDYKLSLFDLQTSSYQALQRVLVSLGHHDEALAVAERGRTRAF
ADLLVERQTGQQDSDPYSPVTIDQILEMVNGQRGLVLYYSLAAGYLYSWLLAPGAGIVKF
HEHYLGENTVENSSDFQASSSVTLPTATGSALEQHIASVREALGVESHYSRACASSETES
EAGDIMDQQFEEMNNKLNSVTDPTGFLRMVRRNNLFNRSCQSMTSLFSNTVSPTQDGTSS
LPRRQSSFAKPPLRALYDLLIAPMEGGLMHSSGPVGRHRQLILVLEGELYLIPFALLKGS
SSNEYLYERFGLLAVPSIRSLSVQSKSHLRKNPPTYSSSTSMAAVIGNPKLPSAVMDRWL
WGPMPSAEEEAYMVSELLGCQPLVGSVATKERVMSALTQAECVHFATHISWKLSALVLTP
SMDGNPASSKSSFGHPYTIPESLRVQDDASDGESISDCPPLQELLLTAADVLDLQLPVKL
VVLGSSQESNSKVTADGVIALTRAFLAAGAQCVLVSLWPVPVAASKMFIHAFYSSLLNGL
KASAALGEAMKVVQSSKAFSHPSNWAGFMLIGSDVKLNSPSSLIGQALTEILQHPERARD
ALRVLLHLVEKSLQRIQNGQRNAMYTSQQSVENKVGGIPGWQALLTAVGFRLDPPTSGLP
AAVFFPTSDPGDRLQQCSSTLQSLLGLPNPALQALCKLITASETGEQLISRAVKNMVGML
HQVLVQLQAGEKEQDLASAPIQVSISVQLWRLPGCHEFLAALGFDLCEVGQEEVILKTGK
QANRRTVHFALQSLLSLFDSTELPKRLSLDSSSSLESLASAQSVSNALPLGYQQPPFSPT
GADSIASDAISVYSLSSIASSMSFVSKPEGGSEGGGPGGRQDHDRSKNAYLQRSTLPRSQ
LPPQTRPAGNKDEEEYEGFSIISNEPLATYQENRNTCFSPDHKQPQPGTAGGMRVSVSSK
GSISTPNSPVKMTLIPSPNSPFQKVGKLASSDTGESDQSSTETDSTVKSQEESNPKLDPQ
ELAQKILEETQSHLIAVERLQRSGGQVSKSNNPEDGVQAPSSTAVFRASETSAFSRPVLS
HQKSQPSPVTVKPKPPARSSSLPKVSSGYSSPTTSEMSIKDSPSQHSGRPSPGCDSQTSQ
LDQPLFKLKYPSSPYSAHISKSPRNMSPSSGHQSPAGSAPSPALSYSSAGSARSSPADAP
DIDKLKMAAIDEKVQAVHNLKMFWQSTPQHSTGPMKIFRGAPGTMTSKRDVLSLLNLSPR
HNKKEEGVDKLELKELSLQQHDGAPPKAPPNGHWRTETTSLGSLPLPAGPPATAPARPLR
LPSGNGYKFLSPGRFFPSSKC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96AY4	0.999	0.999	0.000	2481	1.000	1.000	Q96AY4.pdb.gz	TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4
2	PDB:4bujB	0.148	0.211	1.756E-21	1367	0.069	0.126	4bujB.pdb.gz
3	AFDB:A0A024R0F8	0.124	0.415	1.415E-16	684	0.048	0.174	A0A024R0F8.pdb.gz
4	PDB:7nj1A	0.213	0.309	1.393E-15	1448	0.081	0.140	7nj1A.pdb.gz
5	PDB:7dkhI	0.184	0.404	2.842E-15	914	0.053	0.144	7dkhI.pdb.gz
6	PDB:7n6g1N	0.184	0.204	3.464E-15	2179	0.099	0.112	7n6g1N.pdb.gz	Cryo-EM structure of an active central apparatus.
7	PDB:7qdrB	0.186	0.340	4.059E-15	1212	0.065	0.134	7qdrB.pdb.gz
8	PDB:7sqcR1	0.152	0.171	1.386E-14	2080	0.100	0.120	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
9	PDB:5u1sA	0.196	0.271	3.708E-13	1488	0.083	0.138	5u1sA.pdb.gz
10	PDB:7nj0A	0.181	0.335	2.386E-12	1188	0.069	0.145	7nj0A.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
11	PDB:6tedQ	0.160	0.383	8.814E-12	890	0.060	0.167	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
12	PDB:7ntfA	0.148	0.361	4.130E-11	918	0.043	0.117	7ntfA.pdb.gz
13	AFDB:P73344	0.084	0.341	6.378E-9	429	0.025	0.145	P73344.pdb.gz	P73344_SYNY3 Slr1196 protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr1196 PE=4 SV=1
14	AFDB:Q5UIP0	0.087	0.087	9.860E-9	2472	0.101	0.102	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
15	AFDB:O15550	0.119	0.203	6.752E-5	1401	0.049	0.086	O15550.pdb.gz	KDM6A_HUMAN Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=2
16	AFDB:Q9VW47	0.066	0.066	5.508E-4	2531	0.114	0.112	Q9VW47.pdb.gz	MED12_DROME Mediator of RNA polymerase II transcription subunit 12 OS=Drosophila melanogaster OX=7227 GN=kto PE=1 SV=2
17	AFDB:Q9VAS9	0.060	0.061	1.670E-3	2417	0.100	0.103	Q9VAS9.pdb.gz	Q9VAS9_DROME APC-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Apc PE=3 SV=1
18	AFDB:F4HZK4	0.081	0.119	2.024E-2	1608	0.050	0.076	F4HZK4.pdb.gz	REC3_ARATH Protein REDUCED CHLOROPLAST COVERAGE 3 OS=Arabidopsis thaliana OX=3702 GN=REC3 PE=3 SV=1
19	AFDB:P17672	0.049	0.065	3.008E-2	1355	0.082	0.150	P17672.pdb.gz	E75BA_DROME Ecdysone-induced protein 75B, isoform A OS=Drosophila melanogaster OX=7227 GN=Eip75B PE=2 SV=2
20	AFDB:E9QEX9	0.065	0.063	5.897E-2	2607	0.106	0.101	E9QEX9.pdb.gz	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F6QN66	0.0	5070	2481	0.990	0.990	F6QN66_MACMU Tetratricopeptide repeat domain 28 OS=Macaca mulatta OX=9544 GN=TTC28 PE=4 SV=1
2	Q96AY4	0.0	5121	2481	1.000	1.000	TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4
3	Q8VDU0	1.65e-54	206	679	0.050	0.181	GPSM2_MOUSE G-protein-signaling modulator 2 OS=Mus musculus OX=10090 GN=Gpsm2 PE=1 SV=2
4	H0Y4A4	1.87e-54	205	627	0.048	0.191	H0Y4A4_HUMAN G protein signaling modulator 2 OS=Homo sapiens OX=9606 GN=GPSM2 PE=1 SV=2
5	P81274	3.81e-54	205	684	0.048	0.175	GPSM2_HUMAN G-protein-signaling modulator 2 OS=Homo sapiens OX=9606 GN=GPSM2 PE=1 SV=3
6	Q9R080	2.14e-51	197	673	0.048	0.178	GPSM1_RAT G-protein-signaling modulator 1 OS=Rattus norvegicus OX=10116 GN=Gpsm1 PE=1 SV=2
7	Q6IR34	5.27e-51	196	673	0.048	0.178	GPSM1_MOUSE G-protein-signaling modulator 1 OS=Mus musculus OX=10090 GN=Gpsm1 PE=1 SV=3
8	Q9NFR7	3.60e-50	193	658	0.050	0.190	Q9NFR7_DROME Rapsynoid OS=Drosophila melanogaster OX=7227 GN=pins PE=2 SV=1
9	Q9VB22	5.02e-50	192	658	0.050	0.190	Q9VB22_DROME LD33695p OS=Drosophila melanogaster OX=7227 GN=pins PE=1 SV=1
10	Q9NH88	5.87e-50	192	658	0.050	0.190	Q9NH88_DROME Partner of Inscuteable OS=Drosophila melanogaster OX=7227 GN=pins PE=2 SV=1
11	A0A0A0MRC4	4.79e-49	190	707	0.051	0.180	A0A0A0MRC4_HUMAN G protein signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=2
12	Q86YR5	1.86e-48	188	675	0.048	0.176	GPSM1_HUMAN G-protein-signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=2
13	A0A0A0MSK4	2.16e-48	188	675	0.048	0.176	A0A0A0MSK4_HUMAN G protein signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=1
14	Q19955	1.33e-26	120	579	0.037	0.157	Q19955_CAEEL Tetratricopeptide repeat protein 28 OS=Caenorhabditis elegans OX=6239 GN=ags-3 PE=1 SV=1
15	A0A0R4IVJ0	3.07e-22	107	1102	0.050	0.112	A0A0R4IVJ0_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=ogt.2 PE=1 SV=1
16	Q5GA11	1.82e-20	102	1046	0.047	0.112	Q5GA11_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
17	Q5GA12	1.82e-20	102	1052	0.047	0.111	Q5GA12_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
18	Q5GA13	1.83e-20	102	1062	0.047	0.110	Q5GA13_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
19	Q5GA10	1.95e-20	102	1036	0.047	0.113	Q5GA10_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
20	Q8CGY8	2.25e-20	101	1046	0.046	0.109	OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12862 ANAPC5	35	15.8	Anaphase-promoting complex subunit 5
2	PF12770 CHAT	7.2e-72	253.9	CHAT domain
3	PF12968 DUF3856	3.9e+02	12.5	Domain of Unknown Function (DUF3856)
4	PF07730 HisKA_3	4e+02	13.0	Histidine kinase
5	PF09409 PUB	17	16.8	PUB domain
6	PF10579 Rapsyn_N	4.4e-08	44.4	Rapsyn N-terminal myristoylation and linker region
7	PF10602 RPN7	0.00054	31.2	26S proteasome subunit RPN7
8	PF00515 TPR_1	5.2e-81	274.6	Tetratricopeptide repeat
9	PF13374 TPR_10	5.4e-34	126.4	Tetratricopeptide repeat
10	PF13414 TPR_11	0.00066	30.6	TPR repeat
11	PF13424 TPR_12	2.8e-112	378.5	Tetratricopeptide repeat
12	PF13428 TPR_14	5.9e-13	59.4	Tetratricopeptide repeat
13	PF13432 TPR_16	4.4	19.3	Tetratricopeptide repeat
14	PF13431 TPR_17	7.4	18.3	Tetratricopeptide repeat
15	PF14559 TPR_19	0.0002	33.1	Tetratricopeptide repeat
16	PF07719 TPR_2	4.6e-49	171.7	Tetratricopeptide repeat
17	PF07721 TPR_4	0.00015	33.0	Tetratricopeptide repeat
18	PF13174 TPR_6	81	15.3	Tetratricopeptide repeat
19	PF13176 TPR_7	2.2e-93	310.7	Tetratricopeptide repeat
20	PF13181 TPR_8	3.9e-46	162.4	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381003

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368872	0.792	Protein inscuteable homolog
2	9606.ENSP00000254579	0.712	Dynein heavy chain domain 1
3	9606.ENSP00000366221	0.681	Zinc finger protein castor homolog 1
4	9606.ENSP00000246957	0.674	Heat shock protein 75 kDa, mitochondrial
5	9606.ENSP00000335153	0.674	Heat shock protein HSP 90-alpha
6	9606.ENSP00000360609	0.674	Heat shock protein HSP 90-beta
7	9606.ENSP00000216479	0.664	Activator of 90 kDa heat shock protein ATPase homolog 1
8	9606.ENSP00000377970	0.664	Activator of 90 kDa heat shock protein ATPase homolog 2
9	9606.ENSP00000386902	0.663	Putative protein PTGES3L
10	9606.ENSP00000409924	0.663	PTGES3L-AARSD1 readthrough
11	9606.ENSP00000482075	0.663	Prostaglandin E synthase 3
12	9606.ENSP00000294053	0.645	Caseinolytic peptidase B protein homolog
13	9606.ENSP00000482202	0.635	Phosphatidylinositol-glycan biosynthesis class W protein
14	9606.ENSP00000356319	0.630	Kinesin-like protein KIF14
15	9606.ENSP00000414330	0.610	N-acetylaspartylglutamate synthase A
16	9606.ENSP00000373620	0.595	60 kDa heat shock protein, mitochondrial
17	9606.ENSP00000378320	0.585	Tetratricopeptide repeat protein 7A
18	9606.ENSP00000303887	0.561	Serine/threonine-protein kinase DCLK2
19	9606.ENSP00000224073	0.553	Endothelial differentiation-related factor 1
20	9606.ENSP00000367208	0.552	Protein SGT1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019900	1.000	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0051726	0.959	regulation of cell cycle
GO:0007346	0.945	regulation of mitotic cell cycle
GO:0009987	0.704	cellular process
GO:0050896	0.354	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030496	0.999	midbody
GO:0043229	0.999	intracellular organelle
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0005856	0.820	cytoskeleton
GO:0005737	0.795	cytoplasm
GO:0015630	0.777	microtubule cytoskeleton
GO:0043227	0.775	membrane-bounded organelle
GO:0005829	0.744	cytosol
GO:0043231	0.731	intracellular membrane-bounded organelle
GO:0005815	0.552	microtubule organizing center
GO:0005819	0.434	spindle
GO:0051233	0.342	spindle midzone
GO:0072686	0.339	mitotic spindle
GO:0016020	0.327	membrane
GO:0005813	0.317	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]