StarFunc result for job id Q96B01

User Input

>input (352 residues)
MVRPVRHKKPVNYSQFDHSDSDDDFVSATVPLNKKSRTAPKELKQDKPKPNLNNLRKEEI
PVQEKTPKKRLPEGTFSIPASAVPCTKMALDDKLYQRDLEVALALSVKELPTVTTNVQNS
QDKSIEKHGSSKIETMNKSPHISNCSVASDYLDLDKITVEDDVGGVQGKRKAASKAAAQQ
RKILLEGSDGDSANDTEPDFAPGEDSEDDSDFCESEDNDEDFSMRKSKVKEIKKKEVKVK
SPVEKKEKKSKSKCNALVTSVDSAPAAVKSESQSLPKKVSLSSDTTRKPLEIRSPSAESK
KPKWVPPAASGGSRSSSSPLVVVSVKSPNQSLRLGLSRLARVKPLHPNATST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96B01	1.000	1.000	4.683E-50	352	1.000	1.000	Q96B01.pdb.gz	R51A1_HUMAN RAD51-associated protein 1 OS=Homo sapiens OX=9606 GN=RAD51AP1 PE=1 SV=1
2	AFDB:A0A024RCB9	0.095	0.099	7.261E-2	329	0.142	0.152	A0A024RCB9.pdb.gz
3	AFDB:Q7Z3H4	0.065	0.054	7.762E-2	446	0.119	0.094	Q7Z3H4.pdb.gz	SAMD7_HUMAN Sterile alpha motif domain-containing protein 7 OS=Homo sapiens OX=9606 GN=SAMD7 PE=1 SV=1
4	AFDB:Q9BTD8	0.088	0.068	9.481E-2	480	0.139	0.102	Q9BTD8.pdb.gz	RBM42_HUMAN RNA-binding protein 42 OS=Homo sapiens OX=9606 GN=RBM42 PE=1 SV=1
5	AFDB:A9X6Q5	0.091	0.085	1.616E-1	396	0.148	0.131	A9X6Q5.pdb.gz	A9X6Q5_DANRE Krueppel-like factor 4 OS=Danio rerio OX=7955 GN=klf4a PE=2 SV=1
6	AFDB:Q57W30	0.101	0.093	1.847E-1	391	0.170	0.153	Q57W30.pdb.gz	Q57W30_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.590 PE=4 SV=1
7	AFDB:Q56NI9	0.107	0.074	2.110E-1	601	0.173	0.101	Q56NI9.pdb.gz	ESCO2_HUMAN N-acetyltransferase ESCO2 OS=Homo sapiens OX=9606 GN=ESCO2 PE=1 SV=1
8	AFDB:Q57YV4	0.087	0.038	4.698E-1	1028	0.134	0.046	Q57YV4.pdb.gz	Q57YV4_TRYB2 Kinetoplast-associated protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.440 PE=4 SV=1
9	AFDB:M0QZI3	0.075	0.040	5.738E-1	896	0.128	0.050	M0QZI3.pdb.gz
10	AFDB:Q8C8Y5	0.088	0.077	6.557E-1	445	0.108	0.085	Q8C8Y5.pdb.gz	SAMD7_MOUSE Sterile alpha motif domain-containing protein 7 OS=Mus musculus OX=10090 GN=Samd7 PE=2 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96B01	0.0	702	352	1.000	1.000	R51A1_HUMAN RAD51-associated protein 1 OS=Homo sapiens OX=9606 GN=RAD51AP1 PE=1 SV=1
2	Q8C551	3.83e-118	347	337	0.585	0.611	R51A1_MOUSE RAD51-associated protein 1 OS=Mus musculus OX=10090 GN=Rad51ap1 PE=1 SV=2
3	Q9H1E3	2.12e-04	44.7	243	0.062	0.091	NUCKS_HUMAN Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1
4	Q9EPJ0	3.08e-04	43.9	243	0.062	0.091	NUCKS_RAT Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Rattus norvegicus OX=10116 GN=Nucks1 PE=1 SV=1
5	Q80XU3	3.22e-04	43.9	234	0.062	0.094	NUCKS_MOUSE Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Mus musculus OX=10090 GN=Nucks1 PE=1 SV=1
6	Q5ASH9	0.60	34.7	696	0.080	0.040	Q5ASH9_EMENI Serine/threonine-protein kinase sid2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN8751.2 PE=4 SV=1
7	Q8IZC6	2.4	32.7	1860	0.068	0.013	CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens OX=9606 GN=COL27A1 PE=1 SV=1
8	Q09MP3	2.7	32.7	1159	0.045	0.014	R51A2_HUMAN RAD51-associated protein 2 OS=Homo sapiens OX=9606 GN=RAD51AP2 PE=1 SV=1
9	Q9NRR4	6.9	31.2	1374	0.068	0.017	RNC_HUMAN Ribonuclease 3 OS=Homo sapiens OX=9606 GN=DROSHA PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15696 RAD51_interact	2.1e-15	67.9	RAD51 interacting motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000228843

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000372088	0.999	DNA repair protein RAD51 homolog 1
2	9606.ENSP00000216367	0.985	DNA polymerase epsilon subunit 2
3	9606.ENSP00000307491	0.983	WD repeat-containing protein 48
4	9606.ENSP00000369411	0.978	Replication factor C subunit 3
5	9606.ENSP00000376272	0.975	Replication factor C subunit 4
6	9606.ENSP00000368458	0.961	Proliferating cell nuclear antigen
7	9606.ENSP00000261584	0.958	Partner and localizer of BRCA2
8	9606.ENSP00000408295	0.952	Replication factor C subunit 5
9	9606.ENSP00000361310	0.946	DNA polymerase eta
10	9606.ENSP00000355506	0.943	Exonuclease 1
11	9606.ENSP00000263681	0.941	DNA polymerase delta subunit 3
12	9606.ENSP00000376952	0.941	Crossover junction endonuclease EME1
13	9606.ENSP00000343526	0.933	Ubiquitin carboxyl-terminal hydrolase 1
14	9606.ENSP00000406046	0.933	DNA polymerase delta catalytic subunit
15	9606.ENSP00000223129	0.932	Replication protein A 14 kDa subunit
16	9606.ENSP00000055077	0.931	Replication factor C subunit 2
17	9606.ENSP00000353332	0.929	Regulator of telomere elongation helicase 1
18	9606.ENSP00000480186	0.926	DNA polymerase delta subunit 2
19	9606.ENSP00000318977	0.922	Flap endonuclease GEN homolog 1
20	9606.ENSP00000322570	0.922	DNA polymerase epsilon catalytic subunit A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003697	1.000	single-stranded DNA binding
GO:0003690	1.000	double-stranded DNA binding
GO:0062037	1.000	D-loop DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0006281	0.977	DNA repair
GO:0010564	0.974	regulation of cell cycle process
GO:0051128	0.965	regulation of cellular component organization
GO:0006302	0.932	double-strand break repair
GO:0045787	0.931	positive regulation of cell cycle
GO:0051054	0.928	positive regulation of DNA metabolic process
GO:0033043	0.916	regulation of organelle organization
GO:0006310	0.895	DNA recombination
GO:0000725	0.882	recombinational repair
GO:2001020	0.880	regulation of response to DNA damage stimulus
GO:0051783	0.877	regulation of nuclear division
GO:0006282	0.872	regulation of DNA repair
GO:0000018	0.861	regulation of DNA recombination
GO:0010569	0.848	regulation of double-strand break repair via homologous recombination
GO:2001022	0.846	positive regulation of response to DNA damage stimulus
GO:0010212	0.843	response to ionizing radiation
GO:0090068	0.838	positive regulation of cell cycle process
GO:0000724	0.820	double-strand break repair via homologous recombination
GO:0010638	0.797	positive regulation of organelle organization
GO:0071478	0.752	cellular response to radiation
GO:2000241	0.723	regulation of reproductive process
GO:0071479	0.720	cellular response to ionizing radiation
GO:0045739	0.713	positive regulation of DNA repair
GO:0045911	0.686	positive regulation of DNA recombination
GO:2000781	0.680	positive regulation of double-strand break repair
GO:0051785	0.658	positive regulation of nuclear division
GO:0051445	0.657	regulation of meiotic cell cycle
GO:0040020	0.640	regulation of meiotic nuclear division
GO:2000243	0.629	positive regulation of reproductive process
GO:0051446	0.606	positive regulation of meiotic cell cycle
GO:0036297	0.606	interstrand cross-link repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005694	1.000	chromosome
GO:0005654	1.000	nucleoplasm
GO:0000785	0.931	chromatin
GO:0005737	0.712	cytoplasm
GO:0005829	0.547	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]