StarFunc result for job id Q96B36

User Input

>input (256 residues)
MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARR
CLHDIALAHRAATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQL
GISDNGGLFVMDEDATLQDLPPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQY
AKSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLP
RPRLNTSDFQKLKRKY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZH75	0.518	0.517	1.132E-34	257	0.930	0.926	D3ZH75.pdb.gz	D3ZH75_RAT AKT1 substrate 1 OS=Rattus norvegicus OX=10116 GN=Akt1s1 PE=1 SV=2
2	AFDB:Q9D1F4	0.282	0.281	1.887E-33	257	0.938	0.934	Q9D1F4.pdb.gz	AKTS1_MOUSE Proline-rich AKT1 substrate 1 OS=Mus musculus OX=10090 GN=Akt1s1 PE=1 SV=1
3	AFDB:Q7SY22	0.092	0.074	4.587E-1	363	0.148	0.105	Q7SY22.pdb.gz	Q7SY22_DANRE Forkhead box L1 OS=Danio rerio OX=7955 GN=zgc:63595 PE=2 SV=1
4	AFDB:Q04206	0.106	0.060	8.965E-1	551	0.184	0.085	Q04206.pdb.gz	TF65_HUMAN Transcription factor p65 OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=2
5	PDB:7v6cB	0.081	0.080	9.092E-1	260	0.062	0.062	7v6cB.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
6	AFDB:P48751	0.101	0.027	1.253	1232	0.188	0.039	P48751.pdb.gz	B3A3_HUMAN Anion exchange protein 3 OS=Homo sapiens OX=9606 GN=SLC4A3 PE=1 SV=2
7	AFDB:Q12952	0.142	0.116	1.638	345	0.148	0.110	Q12952.pdb.gz	FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens OX=9606 GN=FOXL1 PE=2 SV=2
8	AFDB:P23738	0.121	0.057	1.873	662	0.129	0.050	P23738.pdb.gz	DCHS_MOUSE Histidine decarboxylase OS=Mus musculus OX=10090 GN=Hdc PE=1 SV=2
9	AFDB:P55317	0.103	0.072	1.873	472	0.141	0.076	P55317.pdb.gz	FOXA1_HUMAN Hepatocyte nuclear factor 3-alpha OS=Homo sapiens OX=9606 GN=FOXA1 PE=1 SV=2
10	PDB:3htxD	0.094	0.038	2.031	795	0.031	0.010	3htxD.pdb.gz	Structural insights into mechanisms of the small RNA methyltransferase HEN1.
11	PDB:6rlbD	0.104	0.067	2.172	446	0.086	0.049	6rlbD.pdb.gz
12	AFDB:Q38F71	0.149	0.125	2.449	350	0.152	0.111	Q38F71.pdb.gz	Q38F71_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3320 PE=4 SV=1
13	AFDB:F1LYX9	0.117	0.041	2.800	1128	0.141	0.032	F1LYX9.pdb.gz	F1LYX9_RAT Desmoglein 2 OS=Rattus norvegicus OX=10116 GN=Dsg2 PE=1 SV=2
14	PDB:4xreA	0.102	0.194	3.037	108	0.055	0.130	4xreA.pdb.gz	A secreted protein with plant-specific cysteine-rich motif functions as a mannose-binding lectin that exhibits antifungal activity.
15	PDB:7zpkC	0.084	0.089	3.247	233	0.051	0.056	7zpkC.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
16	PDB:6wg3A	0.135	0.071	4.854	561	0.051	0.023	6wg3A.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
17	PDB:3gtyS	0.109	0.166	5.190	149	0.074	0.128	3gtyS.pdb.gz
18	PDB:7b7da	0.099	0.193	5.190	87	0.027	0.080	7b7da.pdb.gz	eEF3 promotes late stages of tRNA translocation including E-tRNA release from the ribosome
19	PDB:7qi4f	0.066	0.105	5.190	157	0.016	0.025	7qi4f.pdb.gz	Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
20	PDB:8dgaK	0.083	0.109	6.346	182	0.043	0.060	8dgaK.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96B36	0.0	505	256	1.000	1.000	AKTS1_HUMAN Proline-rich AKT1 substrate 1 OS=Homo sapiens OX=9606 GN=AKT1S1 PE=1 SV=1
2	Q9D1F4	8.76e-133	377	257	0.930	0.926	AKTS1_MOUSE Proline-rich AKT1 substrate 1 OS=Mus musculus OX=10090 GN=Akt1s1 PE=1 SV=1
3	A0A8I5ZRQ9	8.20e-132	375	272	0.918	0.864	A0A8I5ZRQ9_RAT AKT1 substrate 1 OS=Rattus norvegicus OX=10116 GN=Akt1s1 PE=1 SV=1
4	D3ZH75	4.41e-68	213	255	0.586	0.588	D3ZH75_RAT AKT1 substrate 1 OS=Rattus norvegicus OX=10116 GN=Akt1s1 PE=1 SV=2
5	Q7JXA2	6.04e-04	43.1	562	0.098	0.044	Q7JXA2_DROME LOBE OS=Drosophila melanogaster OX=7227 GN=PRAS40 PE=1 SV=1
6	Q7L2K0	6.7	30.4	433	0.129	0.076	TEDC2_HUMAN Tubulin epsilon and delta complex protein 2 OS=Homo sapiens OX=9606 GN=TEDC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15798 PRAS	2.7e-39	146.0	Proline-rich AKT1 substrate 1
2	PF04520 Senescence_reg	3.1e+02	13.5	Senescence regulator

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375711

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307272	0.999	Regulatory-associated protein of mTOR
2	9606.ENSP00000354558	0.999	Serine/threonine-protein kinase mTOR
3	9606.ENSP00000456405	0.999	Target of rapamycin complex subunit LST8
4	9606.ENSP00000286234	0.998	DEP domain-containing mTOR-interacting protein
5	9606.ENSP00000451828	0.992	RAC-alpha serine/threonine-protein kinase
6	9606.ENSP00000248975	0.991	14-3-3 protein eta
7	9606.ENSP00000362092	0.991	Ras-related GTP-binding protein C
8	9606.ENSP00000369899	0.991	Ras-related GTP-binding protein A
9	9606.ENSP00000225577	0.985	Ribosomal protein S6 kinase beta-1
10	9606.ENSP00000340691	0.981	Eukaryotic translation initiation factor 4E-binding protein 1
11	9606.ENSP00000262187	0.975	GTP-binding protein Rheb
12	9606.ENSP00000375892	0.971	RAC-beta serine/threonine-protein kinase
13	9606.ENSP00000379287	0.970	14-3-3 protein zeta/delta
14	9606.ENSP00000264255	0.969	Thioredoxin domain-containing protein 9
15	9606.ENSP00000263826	0.966	RAC-gamma serine/threonine-protein kinase
16	9606.ENSP00000425561	0.964	Eukaryotic translation initiation factor 4E
17	9606.ENSP00000361930	0.959	14-3-3 protein beta/alpha
18	9606.ENSP00000371267	0.959	14-3-3 protein theta
19	9606.ENSP00000262850	0.954	Ras-related GTP-binding protein B
20	9606.ENSP00000306330	0.950	14-3-3 protein gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0019222	0.965	regulation of metabolic process
GO:0031323	0.962	regulation of cellular metabolic process
GO:0048519	0.960	negative regulation of biological process
GO:0048523	0.951	negative regulation of cellular process
GO:0048583	0.925	regulation of response to stimulus
GO:0060255	0.885	regulation of macromolecule metabolic process
GO:0080090	0.884	regulation of primary metabolic process
GO:0023051	0.883	regulation of signaling
GO:0010646	0.883	regulation of cell communication
GO:0051171	0.882	regulation of nitrogen compound metabolic process
GO:1902531	0.854	regulation of intracellular signal transduction
GO:0048585	0.767	negative regulation of response to stimulus
GO:0032006	0.736	regulation of TOR signaling
GO:1902532	0.736	negative regulation of intracellular signal transduction
GO:0051246	0.683	regulation of protein metabolic process
GO:0065009	0.661	regulation of molecular function
GO:0071840	0.650	cellular component organization or biogenesis
GO:0009892	0.645	negative regulation of metabolic process
GO:0032007	0.621	negative regulation of TOR signaling
GO:0031399	0.588	regulation of protein modification process
GO:0050790	0.570	regulation of catalytic activity
GO:0019220	0.543	regulation of phosphate metabolic process
GO:0050896	0.520	response to stimulus
GO:0010941	0.504	regulation of cell death
GO:0016043	0.494	cellular component organization
GO:0031324	0.494	negative regulation of cellular metabolic process
GO:0010605	0.484	negative regulation of macromolecule metabolic process
GO:0051172	0.471	negative regulation of nitrogen compound metabolic process
GO:0051716	0.469	cellular response to stimulus
GO:0007165	0.459	signal transduction
GO:0051248	0.455	negative regulation of protein metabolic process
GO:0051338	0.452	regulation of transferase activity
GO:0042325	0.450	regulation of phosphorylation
GO:0001932	0.443	regulation of protein phosphorylation
GO:0065008	0.430	regulation of biological quality
GO:0042981	0.415	regulation of apoptotic process
GO:0044092	0.410	negative regulation of molecular function
GO:0043549	0.387	regulation of kinase activity
GO:0043086	0.374	negative regulation of catalytic activity
GO:0045936	0.361	negative regulation of phosphate metabolic process
GO:0045859	0.360	regulation of protein kinase activity
GO:0031400	0.351	negative regulation of protein modification process
GO:0008152	0.349	metabolic process
GO:0051348	0.348	negative regulation of transferase activity
GO:0048518	0.325	positive regulation of biological process
GO:0048522	0.316	positive regulation of cellular process
GO:0071704	0.314	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	0.973	intracellular membrane-bounded organelle
GO:0032991	0.962	protein-containing complex
GO:0005634	0.956	nucleus
GO:0070013	0.831	intracellular organelle lumen
GO:0031981	0.682	nuclear lumen
GO:0005654	0.644	nucleoplasm
GO:0016020	0.474	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]