StarFunc result for job id Q96B67

User Input

>input (414 residues)
MVLGKVKSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWT
ESRNAGSNTAYTQNYTEEVEYFNHKDILIGHERDDDNSEEGFHTIHSGRHEYAFSFELPQ
TPLATSFEGRHGSVRYWVKAELHRPWLLPVKLKKEFTVFEHIDINTPSLLSPQAGTKEKT
LCCWFCTSGPISLSAKIERKGYTPGESIQIFAEIENCSSRMVVPKAAIYQTQAFYAKGKM
KEVKQLVANLRGESLSSGKTETWNGKLLKIPPVSPSILDCSIIRVEYSLMVYVDIPGAMD
LFLNLPLVIGTIPLHPFGSRTSSVSSQCSMNMNWLSLSLPERPEAPPSYAEVVTEEQRRN
NLAPVSACDDFERALQGPLFAYIQEFRFLPPPLYSEIDPNPDQSADDRPSCPSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TPQ9	0.916	0.916	2.646E-70	414	0.981	0.981	Q7TPQ9.pdb.gz	ARRD3_MOUSE Arrestin domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arrdc3 PE=2 SV=1
2	AFDB:A0A024RC80	0.708	0.702	6.678E-46	418	0.510	0.505	A0A024RC80.pdb.gz
3	AFDB:Q8TBH0	0.733	0.745	6.871E-45	407	0.531	0.541	Q8TBH0.pdb.gz	ARRD2_HUMAN Arrestin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARRDC2 PE=1 SV=2
4	AFDB:A0A0B4J1F4	0.708	0.706	7.213E-45	415	0.502	0.501	A0A0B4J1F4.pdb.gz	ARRD4_MOUSE Arrestin domain-containing protein 4 OS=Mus musculus OX=10090 GN=Arrdc4 PE=1 SV=1
5	AFDB:Q8BG60	0.666	0.693	1.590E-35	397	0.391	0.408	Q8BG60.pdb.gz	TXNIP_MOUSE Thioredoxin-interacting protein OS=Mus musculus OX=10090 GN=Txnip PE=1 SV=1
6	AFDB:Q0E8K8	0.655	0.786	1.864E-26	342	0.213	0.257	Q0E8K8.pdb.gz	Q0E8K8_DROME FI21816p1 OS=Drosophila melanogaster OX=7227 GN=Vdup1 PE=2 SV=1
7	AFDB:Q9XXI4	0.629	0.622	4.689E-26	419	0.251	0.248	Q9XXI4.pdb.gz	Q9XXI4_CAEEL Arrestin C-terminal-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=arrd-7 PE=1 SV=2
8	AFDB:O45782	0.654	0.636	1.020E-25	426	0.222	0.216	O45782.pdb.gz	ARD17_CAEEL Arrestin domain-containing protein 17 OS=Caenorhabditis elegans OX=6239 GN=arrd-17 PE=1 SV=2
9	AFDB:Q20577	0.644	0.763	2.969E-25	346	0.237	0.283	Q20577.pdb.gz	Q20577_CAEEL Arrestin C-terminal-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=arrd-24 PE=1 SV=2
10	AFDB:Q8N5I2	0.631	0.604	5.581E-25	433	0.239	0.229	Q8N5I2.pdb.gz	ARRD1_HUMAN Arrestin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ARRDC1 PE=1 SV=1
11	PDB:5f0jB	0.518	0.685	2.824E-15	306	0.101	0.137	5f0jB.pdb.gz
12	PDB:2r51A	0.507	0.707	1.027E-13	288	0.106	0.153	2r51A.pdb.gz
13	PDB:3gc3A	0.422	0.512	2.086E-12	329	0.140	0.176	3gc3A.pdb.gz
14	PDB:5tv1A	0.444	0.529	3.390E-12	337	0.123	0.151	5tv1A.pdb.gz	Structural basis of arrestin-3 activation and signaling.
15	PDB:2wtrB	0.443	0.491	8.124E-12	367	0.143	0.161	2wtrB.pdb.gz
16	PDB:7jsmB	0.437	0.467	4.235E-11	383	0.123	0.133	7jsmB.pdb.gz
17	PDB:5w0pC	0.430	0.227	6.883E-11	850	0.128	0.062	5w0pC.pdb.gz
18	PDB:3gd1E	0.373	0.487	7.804E-10	300	0.128	0.177	3gd1E.pdb.gz	Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
19	PDB:5mhlA	0.189	0.123	2.357E-6	692	0.060	0.036	5mhlA.pdb.gz	Structure of active coagulation factor XIII triggered by calcium binding: basis for the design of next-generation anticoagulants.
20	PDB:2q3zA	0.191	0.133	6.723E-5	655	0.060	0.038	2q3zA.pdb.gz	Transglutaminase 2 undergoes a large conformational change upon activation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7TPQ9	0.0	849	414	0.981	0.981	ARRD3_MOUSE Arrestin domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arrdc3 PE=2 SV=1
2	Q96B67	0.0	862	414	1.000	1.000	ARRD3_HUMAN Arrestin domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ARRDC3 PE=1 SV=1
3	Q8TBH0	1.06e-153	442	407	0.529	0.538	ARRD2_HUMAN Arrestin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARRDC2 PE=1 SV=2
4	Q8NCT1	6.57e-146	423	418	0.512	0.507	ARRD4_HUMAN Arrestin domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ARRDC4 PE=1 SV=3
5	A0A0B4J1F4	1.73e-142	414	415	0.512	0.511	ARRD4_MOUSE Arrestin domain-containing protein 4 OS=Mus musculus OX=10090 GN=Arrdc4 PE=1 SV=1
6	Q5M7W1	7.86e-104	315	394	0.399	0.419	TXNIP_RAT Thioredoxin-interacting protein OS=Rattus norvegicus OX=10116 GN=Txnip PE=2 SV=1
7	Q8BG60	1.69e-103	314	397	0.391	0.408	TXNIP_MOUSE Thioredoxin-interacting protein OS=Mus musculus OX=10090 GN=Txnip PE=1 SV=1
8	Q9H3M7	3.55e-103	313	391	0.403	0.427	TXNIP_HUMAN Thioredoxin-interacting protein OS=Homo sapiens OX=9606 GN=TXNIP PE=1 SV=1
9	Q9XXI4	3.65e-31	125	419	0.256	0.253	Q9XXI4_CAEEL Arrestin C-terminal-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=arrd-7 PE=1 SV=2
10	O45782	6.00e-30	122	426	0.210	0.204	ARD17_CAEEL Arrestin domain-containing protein 17 OS=Caenorhabditis elegans OX=6239 GN=arrd-17 PE=1 SV=2
11	Q20577	6.18e-26	109	346	0.217	0.260	Q20577_CAEEL Arrestin C-terminal-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=arrd-24 PE=1 SV=2
12	Q8SYE1	2.81e-23	102	342	0.210	0.254	Q8SYE1_DROME RE65532p OS=Drosophila melanogaster OX=7227 GN=Vdup1 PE=2 SV=1
13	Q0E8K8	5.89e-23	100	342	0.210	0.254	Q0E8K8_DROME FI21816p1 OS=Drosophila melanogaster OX=7227 GN=Vdup1 PE=2 SV=1
14	Q8N5I2	2.63e-21	97.4	433	0.200	0.192	ARRD1_HUMAN Arrestin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ARRDC1 PE=1 SV=1
15	Q8SYW4	2.66e-17	83.6	271	0.167	0.255	Q8SYW4_DROME RE30730p OS=Drosophila melanogaster OX=7227 GN=Vdup1 PE=2 SV=1
16	Q8SYU5	1.38e-15	80.5	469	0.164	0.145	Q8SYU5_DROME RE33762p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10086 PE=1 SV=1
17	Q9VGU4	4.56e-14	76.3	520	0.167	0.133	Q9VGU4_DROME FI02822p OS=Drosophila melanogaster OX=7227 GN=Leash PE=2 SV=2
18	Q54CH1	2.45e-05	48.9	580	0.176	0.126	ADCA_DICDI Arrestin domain-containing protein A OS=Dictyostelium discoideum OX=44689 GN=adcA PE=1 SV=1
19	Q55CH0	2.57e-05	48.9	654	0.128	0.081	ADCC_DICDI Arrestin domain-containing protein C OS=Dictyostelium discoideum OX=44689 GN=adcC PE=3 SV=1
20	P30647	9.46e-05	46.6	374	0.135	0.150	ARD15_CAEEL Arrestin domain-containing protein 15 OS=Caenorhabditis elegans OX=6239 GN=arrd-15 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02752 Arrestin_C	6.5e-21	86.7	Arrestin (or S-antigen), C-terminal domain
2	PF00339 Arrestin_N	1.3e-34	130.8	Arrestin (or S-antigen), N-terminal domain
3	PF04335 VirB8	5e+02	12.0	VirB8 protein
4	PF03643 Vps26	7.4	17.1	Vacuolar protein sorting-associated protein 26

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265138

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000424827	0.999	E3 ubiquitin-protein ligase NEDD4
2	9606.ENSP00000305372	0.949	Beta-2 adrenergic receptor
3	9606.ENSP00000352069	0.891	NEDD4-like E3 ubiquitin-protein ligase WWP2
4	9606.ENSP00000383199	0.891	E3 ubiquitin-protein ligase NEDD4-like
5	9606.ENSP00000427793	0.835	NEDD4-like E3 ubiquitin-protein ligase WWP1
6	9606.ENSP00000480499	0.796	E3 ubiquitin-protein ligase Itchy homolog
7	9606.ENSP00000478927	0.762	Transcriptional coactivator YAP1
8	9606.ENSP00000314518	0.760	LysM and putative peptidoglycan-binding domain-containing protein 3
9	9606.ENSP00000409581	0.748	Beta-arrestin-1
10	9606.ENSP00000403701	0.730	Beta-arrestin-2
11	9606.ENSP00000386444	0.727	S-arrestin
12	9606.ENSP00000363641	0.711	Thioredoxin
13	9606.ENSP00000281187	0.679	Vacuolar protein sorting-associated protein 26B
14	9606.ENSP00000362480	0.668	Vacuolar protein sorting-associated protein 26A
15	9606.ENSP00000424126	0.647	Multiple C2 and transmembrane domain-containing protein 1
16	9606.ENSP00000311399	0.602	Down syndrome critical region gene 3
17	9606.ENSP00000350377	0.580	Multiple C2 and transmembrane domain-containing protein 2
18	9606.ENSP00000346151	0.575	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
19	9606.ENSP00000331201	0.567	Hepatocyte growth factor-regulated tyrosine kinase substrate
20	9606.ENSP00000265372	0.563	cAMP responsive element modulator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001664	0.999	G protein-coupled receptor binding
GO:0031690	0.992	adrenergic receptor binding
GO:0019899	0.562	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0019222	0.991	regulation of metabolic process
GO:0009966	0.991	regulation of signal transduction
GO:0080090	0.972	regulation of primary metabolic process
GO:0051171	0.972	regulation of nitrogen compound metabolic process
GO:0048518	0.959	positive regulation of biological process
GO:0060255	0.912	regulation of macromolecule metabolic process
GO:0048519	0.884	negative regulation of biological process
GO:0048522	0.857	positive regulation of cellular process
GO:0032501	0.834	multicellular organismal process
GO:1903320	0.828	regulation of protein modification by small protein conjugation or removal
GO:0051247	0.824	positive regulation of protein metabolic process
GO:0031396	0.818	regulation of protein ubiquitination
GO:0035330	0.812	regulation of hippo signaling
GO:0065009	0.805	regulation of molecular function
GO:0009987	0.803	cellular process
GO:0050790	0.785	regulation of catalytic activity
GO:0051338	0.782	regulation of transferase activity
GO:0048856	0.778	anatomical structure development
GO:0051438	0.730	regulation of ubiquitin-protein transferase activity
GO:0048584	0.698	positive regulation of response to stimulus
GO:0048523	0.691	negative regulation of cellular process
GO:0031401	0.688	positive regulation of protein modification process
GO:0023056	0.673	positive regulation of signaling
GO:0010647	0.673	positive regulation of cell communication
GO:0008277	0.671	regulation of G protein-coupled receptor signaling pathway
GO:0044093	0.665	positive regulation of molecular function
GO:1903322	0.656	positive regulation of protein modification by small protein conjugation or removal
GO:0031398	0.654	positive regulation of protein ubiquitination
GO:0051239	0.594	regulation of multicellular organismal process
GO:0048585	0.578	negative regulation of response to stimulus
GO:0043085	0.567	positive regulation of catalytic activity
GO:0009967	0.487	positive regulation of signal transduction
GO:0061448	0.455	connective tissue development
GO:0031323	0.442	regulation of cellular metabolic process
GO:0060612	0.442	adipose tissue development
GO:0009968	0.437	negative regulation of signal transduction
GO:0001659	0.412	temperature homeostasis
GO:0050795	0.397	regulation of behavior
GO:0006810	0.388	transport
GO:0106070	0.382	regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0050896	0.343	response to stimulus
GO:0009892	0.337	negative regulation of metabolic process
GO:1902533	0.331	positive regulation of intracellular signal transduction
GO:0008152	0.312	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031982	0.997	vesicle
GO:0005886	0.997	plasma membrane
GO:0012505	0.995	endomembrane system
GO:0031410	0.992	cytoplasmic vesicle
GO:0005768	0.904	endosome
GO:0005829	0.338	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]