StarFunc result for job id Q96B86

User Input

>input (450 residues)
MQPPRERLVVTGRAGWMGMGRGAGRSALGFWPTLAFLLCSFPAATSPCKILKCNSEFWSA
TSGSHAPASDDTPEFCAALRSYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDGP
TSQPRLRTLPPAGDSQERSDSPEICHYEKSFHKHSATPNYTHCGLFGDPHLRTFTDRFQT
CKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDELP
AAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEV
VNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFPYETA
VAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYDRTRDL
PGRAAAGLPLAPRPLLGALVPLLALLPVFC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PCX7	0.851	0.844	9.213E-77	454	0.918	0.910	Q6PCX7.pdb.gz	RGMA_MOUSE Repulsive guidance molecule A OS=Mus musculus OX=10090 GN=Rgma PE=1 SV=1
2	AFDB:Q8JG54	0.855	0.889	1.104E-68	432	0.773	0.806	Q8JG54.pdb.gz	RGMA_CHICK Repulsive guidance molecule A OS=Gallus gallus OX=9031 GN=RGMA PE=1 SV=1
3	AFDB:Q1LVM8	0.766	0.767	1.778E-62	449	0.631	0.633	Q1LVM8.pdb.gz	Q1LVM8_DANRE Repulsive guidance molecule A OS=Danio rerio OX=7955 GN=dlm PE=1 SV=1
4	AFDB:Q6NW40	0.558	0.574	2.011E-49	437	0.480	0.494	Q6NW40.pdb.gz	RGMB_HUMAN Repulsive guidance molecule B OS=Homo sapiens OX=9606 GN=RGMB PE=1 SV=3
5	AFDB:Q7TQ33	0.536	0.552	7.446E-49	436	0.478	0.493	Q7TQ33.pdb.gz	RGMB_MOUSE Repulsive guidance molecule B OS=Mus musculus OX=10090 GN=Rgmb PE=1 SV=1
6	AFDB:Q6ZVN8	0.555	0.586	5.306E-48	426	0.456	0.481	Q6ZVN8.pdb.gz	RGMC_HUMAN Hemojuvelin OS=Homo sapiens OX=9606 GN=HJV PE=1 SV=1
7	AFDB:A0A0B5JF96	0.551	0.602	6.249E-48	410	0.456	0.500	A0A0B5JF96.pdb.gz
8	AFDB:Q8N7M5	0.550	0.585	7.361E-48	422	0.453	0.483	Q8N7M5.pdb.gz	RGMC_RAT Hemojuvelin OS=Rattus norvegicus OX=10116 GN=Hjv PE=2 SV=1
9	AFDB:B3DGM8	0.526	0.576	7.510E-45	410	0.400	0.439	B3DGM8.pdb.gz
10	AFDB:G5EDE5	0.482	0.529	6.888E-28	408	0.218	0.240	G5EDE5.pdb.gz	RGMB_CAEEL Repulsive guidance molecule B homolog drag-1 OS=Caenorhabditis elegans OX=6239 GN=drag-1 PE=1 SV=1
11	PDB:6z3mc	0.343	0.961	7.153E-23	158	0.238	0.677	6z3mc.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
12	PDB:6z3mP	0.160	0.905	4.062E-7	76	0.102	0.605	6z3mP.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
13	PDB:2qo5A	0.098	0.238	1.155E-2	129	0.042	0.147	2qo5A.pdb.gz
14	PDB:4qdfB	0.068	0.082	1.993E-2	357	0.069	0.087	4qdfB.pdb.gz	Substrate specificities and conformational flexibility of 3-ketosteroid 9 alpha-hydroxylases.
15	PDB:4qdcA	0.079	0.085	3.083E-2	369	0.053	0.065	4qdcA.pdb.gz	Substrate specificities and conformational flexibility of 3-ketosteroid 9 alpha-hydroxylases.
16	PDB:2qosC	0.096	0.192	3.256E-2	173	0.033	0.087	2qosC.pdb.gz	Crystal structure of complement protein C8gamma in complex with a peptide containing the C8gamma binding site on C8alpha: Implications for C8gamma ligand binding.
17	PDB:3p6dA	0.100	0.214	3.835E-2	139	0.044	0.144	3p6dA.pdb.gz	Structural analysis of ibuprofen binding to human adipocyte fatty-acid binding protein (FABP4).
18	PDB:3saoA	0.092	0.196	4.770E-2	150	0.024	0.073	3saoA.pdb.gz	Galline Ex-FABP Is an Antibacterial Siderocalin and a Lysophosphatidic Acid Sensor Functioning through Dual Ligand Specificities.
19	PDB:5n47A	0.076	0.138	4.770E-2	180	0.024	0.061	5n47A.pdb.gz
20	PDB:5t43A	0.073	0.140	5.037E-2	158	0.040	0.114	5t43A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6ACJ0	0.0	746	454	0.813	0.806	A0A8I6ACJ0_RAT Repulsive guidance molecule BMP co-receptor a OS=Rattus norvegicus OX=10116 GN=Rgma PE=3 SV=1
2	D4A188	0.0	832	449	0.904	0.906	D4A188_RAT Repulsive guidance molecule BMP co-receptor a OS=Rattus norvegicus OX=10116 GN=Rgma PE=3 SV=1
3	Q1LVM8	0.0	585	449	0.633	0.635	Q1LVM8_DANRE Repulsive guidance molecule A OS=Danio rerio OX=7955 GN=dlm PE=1 SV=1
4	Q6PCX7	0.0	835	454	0.904	0.896	RGMA_MOUSE Repulsive guidance molecule A OS=Mus musculus OX=10090 GN=Rgma PE=1 SV=1
5	Q8JG54	0.0	714	432	0.771	0.803	RGMA_CHICK Repulsive guidance molecule A OS=Gallus gallus OX=9031 GN=RGMA PE=1 SV=1
6	Q96B86	0.0	938	450	0.998	0.998	RGMA_HUMAN Repulsive guidance molecule A OS=Homo sapiens OX=9606 GN=RGMA PE=1 SV=4
7	Q6NW40	7.62e-137	402	437	0.464	0.478	RGMB_HUMAN Repulsive guidance molecule B OS=Homo sapiens OX=9606 GN=RGMB PE=1 SV=3
8	Q7TQ33	1.16e-135	399	436	0.460	0.475	RGMB_MOUSE Repulsive guidance molecule B OS=Mus musculus OX=10090 GN=Rgmb PE=1 SV=1
9	Q7TQ32	1.97e-125	372	420	0.460	0.493	RGMC_MOUSE Hemojuvelin OS=Mus musculus OX=10090 GN=Hjv PE=1 SV=1
10	Q8N7M5	2.19e-124	369	422	0.458	0.488	RGMC_RAT Hemojuvelin OS=Rattus norvegicus OX=10116 GN=Hjv PE=2 SV=1
11	Q6ZVN8	1.27e-113	342	426	0.447	0.472	RGMC_HUMAN Hemojuvelin OS=Homo sapiens OX=9606 GN=HJV PE=1 SV=1
12	Q1JQE7	1.52e-111	336	410	0.398	0.437	Q1JQE7_DANRE Hemochromatosis type 2 OS=Danio rerio OX=7955 GN=hfe2 PE=1 SV=1
13	G5EDE5	6.58e-28	116	408	0.229	0.252	RGMB_CAEEL Repulsive guidance molecule B homolog drag-1 OS=Caenorhabditis elegans OX=6239 GN=drag-1 PE=1 SV=1
14	P9WKX5	1.8	33.1	340	0.060	0.079	Y3679_MYCTU Putative ATPase Rv3679 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3679 PE=1 SV=1
15	G7H806	5.2	31.6	230	0.029	0.057	G7H806_DROME FI15931p1 OS=Drosophila melanogaster OX=7227 GN=Spf30 PE=1 SV=1
16	Q95RI7	5.9	31.2	243	0.029	0.053	Q95RI7_DROME LD28068p OS=Drosophila melanogaster OX=7227 GN=Spf30 PE=1 SV=1
17	P0CY29	8.3	31.2	398	0.062	0.070	CARP3_CANAL Candidapepsin-3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SAP3 PE=1 SV=1
18	P0A6F1	9.2	31.2	382	0.098	0.115	CARA_ECOLI Carbamoyl-phosphate synthase small chain OS=Escherichia coli (strain K12) OX=83333 GN=carA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06534 RGM_C	5e-70	246.0	Repulsive guidance molecule (RGM) C-terminus
2	PF06535 RGM_N	2.8e-71	250.5	Repulsive guidance molecule (RGM) N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000013049

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000009677	0.985	Bone morphogenetic protein 2
2	60711.ENSCSAP00000010098	0.982	Neogenin 1
3	60711.ENSCSAP00000005943	0.950	Bone morphogenetic protein receptor, type IA
4	60711.ENSCSAP00000010950	0.928	Bone morphogenetic protein 4
5	60711.ENSCSAP00000011444	0.928	Repulsive guidance molecule family member b
6	60711.ENSCSAP00000012006	0.899	Serine/threonine-protein kinase receptor
7	60711.ENSCSAP00000000496	0.836	Serine/threonine-protein kinase receptor
8	60711.ENSCSAP00000006660	0.734	Growth differentiation factor 5
9	60711.ENSCSAP00000009511	0.716	Mothers against decapentaplegic homolog
10	60711.ENSCSAP00000014118	0.702	DCC netrin 1 receptor
11	60711.ENSCSAP00000006711	0.696	Bone morphogenetic protein receptor, type II (serine/threonine kinase)
12	60711.ENSCSAP00000007902	0.693	Negatively regulates TGF-beta signaling.
13	60711.ENSCSAP00000005075	0.674	Chordin-like 1
14	60711.ENSCSAP00000017457	0.671	Inhibitor of bone morphogenetic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite
15	60711.ENSCSAP00000014620	0.663	Mothers against decapentaplegic homolog
16	60711.ENSCSAP00000009423	0.656	Bone morphogenetic protein 5
17	60711.ENSCSAP00000009026	0.649	Immunoglobulin superfamily, DCC subclass, member 3
18	60711.ENSCSAP00000006652	0.646	Dorsal root ganglia homeobox
19	60711.ENSCSAP00000019251	0.645	Gremlin 1, DAN family BMP antagonist
20	60711.ENSCSAP00000009897	0.640	Dorsalizing factor. Key developmental protein that dorsalizes early vertebrate embryonic tissues by binding to ventralizing TGF-beta family bone morphogenetic proteins (BMPs) and sequestering them in latent complexes

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0038023	0.952	signaling receptor activity
GO:0015026	0.942	coreceptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.982	regulation of cellular process
GO:0048518	0.980	positive regulation of biological process
GO:0048522	0.972	positive regulation of cellular process
GO:0050896	0.967	response to stimulus
GO:0009987	0.967	cellular process
GO:0019222	0.966	regulation of metabolic process
GO:0051171	0.958	regulation of nitrogen compound metabolic process
GO:0060255	0.957	regulation of macromolecule metabolic process
GO:0048583	0.952	regulation of response to stimulus
GO:0032502	0.950	developmental process
GO:0080090	0.948	regulation of primary metabolic process
GO:0048856	0.937	anatomical structure development
GO:0031323	0.933	regulation of cellular metabolic process
GO:0051716	0.928	cellular response to stimulus
GO:0009893	0.922	positive regulation of metabolic process
GO:0023052	0.914	signaling
GO:0051173	0.914	positive regulation of nitrogen compound metabolic process
GO:0045596	0.906	negative regulation of cell differentiation
GO:0010604	0.896	positive regulation of macromolecule metabolic process
GO:0070848	0.890	response to growth factor
GO:0007178	0.886	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0010721	0.875	negative regulation of cell development
GO:0051241	0.874	negative regulation of multicellular organismal process
GO:0050770	0.872	regulation of axonogenesis
GO:0061387	0.872	regulation of extent of cell growth
GO:0031325	0.871	positive regulation of cellular metabolic process
GO:0019219	0.863	regulation of nucleobase-containing compound metabolic process
GO:0071773	0.857	cellular response to BMP stimulus
GO:0030509	0.842	BMP signaling pathway
GO:0009889	0.830	regulation of biosynthetic process
GO:0051252	0.825	regulation of RNA metabolic process
GO:0010646	0.822	regulation of cell communication
GO:0023051	0.821	regulation of signaling
GO:0048670	0.817	regulation of collateral sprouting
GO:0050768	0.807	negative regulation of neurogenesis
GO:0045926	0.797	negative regulation of growth
GO:0010468	0.795	regulation of gene expression
GO:0045935	0.791	positive regulation of nucleobase-containing compound metabolic process
GO:0009966	0.777	regulation of signal transduction
GO:0009891	0.764	positive regulation of biosynthetic process
GO:0031326	0.756	regulation of cellular biosynthetic process
GO:0051254	0.741	positive regulation of RNA metabolic process
GO:0048585	0.731	negative regulation of response to stimulus
GO:0031328	0.727	positive regulation of cellular biosynthetic process
GO:0010556	0.724	regulation of macromolecule biosynthetic process
GO:0006355	0.712	regulation of DNA-templated transcription
GO:0010557	0.698	positive regulation of macromolecule biosynthetic process
GO:0080135	0.696	regulation of cellular response to stress
GO:0032501	0.690	multicellular organismal process
GO:0045893	0.681	positive regulation of DNA-templated transcription
GO:1903034	0.663	regulation of response to wounding
GO:0071704	0.637	organic substance metabolic process
GO:0044238	0.631	primary metabolic process
GO:0051130	0.628	positive regulation of cellular component organization
GO:0006807	0.611	nitrogen compound metabolic process
GO:1903035	0.606	negative regulation of response to wounding
GO:0007275	0.591	multicellular organism development
GO:0043170	0.584	macromolecule metabolic process
GO:0010977	0.547	negative regulation of neuron projection development
GO:0006357	0.496	regulation of transcription by RNA polymerase II
GO:0048731	0.493	system development
GO:0090092	0.471	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0070570	0.427	regulation of neuron projection regeneration
GO:0051246	0.398	regulation of protein metabolic process
GO:0051247	0.386	positive regulation of protein metabolic process
GO:0048584	0.377	positive regulation of response to stimulus
GO:0009653	0.370	anatomical structure morphogenesis
GO:0048869	0.356	cellular developmental process
GO:0030154	0.352	cell differentiation
GO:0009892	0.350	negative regulation of metabolic process
GO:0065009	0.335	regulation of molecular function
GO:0019538	0.319	protein metabolic process
GO:0051094	0.314	positive regulation of developmental process
GO:0090287	0.308	regulation of cellular response to growth factor stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0012505	0.990	endomembrane system
GO:0005737	0.981	cytoplasm
GO:0043231	0.980	intracellular membrane-bounded organelle
GO:0071944	0.969	cell periphery
GO:0005886	0.962	plasma membrane
GO:0005576	0.584	extracellular region
GO:0043233	0.422	organelle lumen
GO:0070013	0.414	intracellular organelle lumen
GO:0009986	0.313	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]