StarFunc result for job id Q96B97

User Input

>input (665 residues)
MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEM
KKDPLTNKAPEKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELK
VGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTG
SESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPV
EKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKD
CIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQGAGTTERKHE
IKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALPPR
RPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPT
TSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTIS
QVSDNKASLPPKPGTMAAGGGGPAPLSSAAPSPLSSSLGTAGHRANSPSLFGTEGKPKME
PAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDIKK
ALQSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JPT6	0.227	0.227	1.015E-83	665	1.000	1.000	Q5JPT6.pdb.gz	Q5JPT6_HUMAN GIG10 OS=Homo sapiens OX=9606 PE=1 SV=1
2	AFDB:Q8R550	0.190	0.180	2.321E-79	709	0.940	0.882	Q8R550.pdb.gz	SH3K1_MOUSE SH3 domain-containing kinase-binding protein 1 OS=Mus musculus OX=10090 GN=Sh3kbp1 PE=1 SV=1
3	AFDB:Q5ZMQ7	0.236	0.216	9.742E-71	739	0.783	0.705	Q5ZMQ7.pdb.gz	Q5ZMQ7_CHICK SH3 domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_1g20 PE=1 SV=1
4	AFDB:E9QJP6	0.179	0.178	4.142E-50	669	0.553	0.550	E9QJP6.pdb.gz
5	AFDB:F1R1N9	0.191	0.193	1.254E-39	657	0.398	0.403	F1R1N9.pdb.gz	F1R1N9_DANRE CD2-associated protein OS=Danio rerio OX=7955 GN=cd2apl PE=1 SV=1
6	AFDB:F1LRS8	0.135	0.139	2.561E-38	637	0.379	0.396	F1LRS8.pdb.gz	CD2AP_RAT CD2-associated protein OS=Rattus norvegicus OX=10116 GN=Cd2ap PE=1 SV=2
7	AFDB:Q9Y5K6	0.161	0.167	1.327E-37	639	0.367	0.382	Q9Y5K6.pdb.gz	CD2AP_HUMAN CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1
8	AFDB:Q9VA36	0.146	0.115	2.205E-24	882	0.232	0.175	Q9VA36.pdb.gz	Q9VA36_DROME CIN85 and CD2AP related, isoform C OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=2
9	AFDB:A0A0B4KI34	0.187	0.139	5.917E-24	941	0.235	0.166	A0A0B4KI34.pdb.gz	A0A0B4KI34_DROME CIN85 and CD2AP related, isoform J OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=1
10	AFDB:Q5TCZ1	0.132	0.086	4.531E-17	1133	0.167	0.098	Q5TCZ1.pdb.gz	SPD2A_HUMAN SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A PE=1 SV=1
11	PDB:2lqnA	0.107	0.197	1.783E-8	303	0.056	0.122	2lqnA.pdb.gz
12	PDB:1griA	0.104	0.304	4.785E-8	211	0.080	0.251	1griA.pdb.gz
13	PDB:2eyzA	0.099	0.191	1.691E-6	304	0.057	0.125	2eyzA.pdb.gz
14	PDB:2dybA	0.086	0.190	1.035E-4	298	0.030	0.067	2dybA.pdb.gz
15	PDB:6x5hA	0.083	0.118	2.777E-4	467	0.027	0.039	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
16	PDB:1k9aB	0.085	0.127	3.859E-4	441	0.021	0.032	1k9aB.pdb.gz
17	PDB:3ehqA	0.082	0.291	3.859E-4	182	0.026	0.093	3ehqA.pdb.gz
18	PDB:3qwyA	0.082	0.317	3.859E-4	170	0.030	0.118	3qwyA.pdb.gz
19	PDB:2h8hA	0.079	0.117	1.606E-3	445	0.023	0.034	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
20	PDB:4mt6A	0.076	0.129	2.232E-3	389	0.021	0.036	4mt6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JPT6	0.0	1334	665	1.000	1.000	Q5JPT6_HUMAN GIG10 OS=Homo sapiens OX=9606 PE=1 SV=1
2	Q5ZMQ7	0.0	956	739	0.782	0.704	Q5ZMQ7_CHICK SH3 domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_1g20 PE=1 SV=1
3	Q8R550	0.0	1101	709	0.941	0.883	SH3K1_MOUSE SH3 domain-containing kinase-binding protein 1 OS=Mus musculus OX=10090 GN=Sh3kbp1 PE=1 SV=1
4	Q925Q9	0.0	1090	709	0.935	0.877	SH3K1_RAT SH3 domain-containing kinase-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Sh3kbp1 PE=1 SV=2
5	Q96B97	0.0	1334	665	1.000	1.000	SH3K1_HUMAN SH3 domain-containing kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3KBP1 PE=1 SV=2
6	F1R1N9	1.13e-91	300	657	0.374	0.379	F1R1N9_DANRE CD2-associated protein OS=Danio rerio OX=7955 GN=cd2apl PE=1 SV=1
7	Q9Y5K6	2.01e-85	283	639	0.244	0.254	CD2AP_HUMAN CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1
8	F1LRS8	2.83e-85	282	637	0.241	0.251	CD2AP_RAT CD2-associated protein OS=Rattus norvegicus OX=10116 GN=Cd2ap PE=1 SV=2
9	Q80ZE7	2.31e-84	280	637	0.239	0.250	Q80ZE7_RAT CD2AP/CMS OS=Rattus norvegicus OX=10116 GN=Cd2ap PE=2 SV=1
10	Q5PR31	2.90e-45	164	279	0.171	0.409	Q5PR31_DANRE CD2-associated protein like OS=Danio rerio OX=7955 GN=cd2apl PE=2 SV=1
11	Q7YU85	5.27e-31	132	880	0.095	0.072	Q7YU85_DROME SD08724p OS=Drosophila melanogaster OX=7227 GN=cindr PE=2 SV=1
12	A0A0B4KI34	6.40e-31	131	941	0.098	0.069	A0A0B4KI34_DROME CIN85 and CD2AP related, isoform J OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=1
13	Q9VA36	6.72e-31	131	882	0.098	0.074	Q9VA36_DROME CIN85 and CD2AP related, isoform C OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=2
14	Q9Z0R4	7.70e-24	110	1714	0.140	0.054	ITSN1_MOUSE Intersectin-1 OS=Mus musculus OX=10090 GN=Itsn1 PE=1 SV=2
15	A0A0U1RQE4	1.11e-23	109	1047	0.120	0.076	A0A0U1RQE4_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
16	Q15811	1.36e-23	109	1721	0.134	0.052	ITSN1_HUMAN Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=3
17	A0A494C1M0	1.45e-23	108	1011	0.120	0.079	A0A494C1M0_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
18	Q5HYK7	1.80e-23	108	790	0.120	0.101	SH319_HUMAN SH3 domain-containing protein 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=2
19	A0A0B4KI32	2.80e-23	107	848	0.078	0.061	A0A0B4KI32_DROME CIN85 and CD2AP related, isoform E OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=1
20	Q91X43	9.96e-23	105	789	0.131	0.110	SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus OX=10090 GN=Sh3d19 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00018 SH3_1	3.3e-39	143.6	SH3 domain
2	PF07653 SH3_2	9.4e-37	135.9	Variant SH3 domain
3	PF14604 SH3_9	5.8e-50	178.3	Variant SH3 domain
4	PF10267 Tmemb_cc2	2.7	18.7	Predicted transmembrane and coiled-coil 2 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380921

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264033	0.999	E3 ubiquitin-protein ligase CBL
2	9606.ENSP00000275493	0.997	Epidermal growth factor receptor
3	9606.ENSP00000224337	0.996	B-cell linker protein
4	9606.ENSP00000369981	0.992	Endophilin-A1
5	9606.ENSP00000441543	0.989	Polyubiquitin-C
6	9606.ENSP00000264122	0.985	E3 ubiquitin-protein ligase CBL-B
7	9606.ENSP00000391249	0.984	Septin-9
8	9606.ENSP00000373905	0.980	Dynamin-2
9	9606.ENSP00000377233	0.980	Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1
10	9606.ENSP00000358490	0.978	T-cell surface antigen CD2
11	9606.ENSP00000317272	0.975	Hepatocyte growth factor receptor
12	9606.ENSP00000272317	0.972	Ubiquitin-40S ribosomal protein S27a
13	9606.ENSP00000360280	0.970	Disabled homolog 1
14	9606.ENSP00000375986	0.967	Mitogen-activated protein kinase kinase kinase 4
15	9606.ENSP00000313391	0.964	Disabled homolog 2
16	9606.ENSP00000428056	0.962	Phosphatidylinositol 3-kinase regulatory subunit alpha
17	9606.ENSP00000361634	0.957	Endophilin-B2
18	9606.ENSP00000265171	0.953	Pro-epidermal growth factor
19	9606.ENSP00000346671	0.946	Tyrosine-protein kinase Fyn
20	9606.ENSP00000376345	0.945	Growth factor receptor-bound protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0048518	0.835	positive regulation of biological process
GO:0048522	0.749	positive regulation of cellular process
GO:0071840	0.675	cellular component organization or biogenesis
GO:0050793	0.653	regulation of developmental process
GO:0016043	0.630	cellular component organization
GO:0002682	0.529	regulation of immune system process
GO:0051239	0.490	regulation of multicellular organismal process
GO:0051249	0.481	regulation of lymphocyte activation
GO:0050864	0.416	regulation of B cell activation
GO:0050896	0.341	response to stimulus
GO:0006996	0.315	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.993	cytosol
GO:0005886	0.990	plasma membrane
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0031982	0.942	vesicle
GO:0031410	0.912	cytoplasmic vesicle
GO:0030054	0.745	cell junction
GO:0030139	0.558	endocytic vesicle
GO:0070161	0.479	anchoring junction
GO:0043232	0.354	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]