StarFunc result for job id Q96BA8

User Input

>input (519 residues)
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALG
HKLCSIMVKQEQSPELPVDPLAAPSAMAAAAAMATTPLLGLSPLSRLPIPHQAPGEMTQL
PVIKAEPLEVNQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPLAADGVYTASQM
PSRSLLFYDDGAGLWEDGRSTLLPMEPPDGWEINPGGPAEQRPRDHLQHDHLDSTHETTK
YLSEAWPKDGGNGTSPDFSHSKEWFHDRDLGPNTTIKLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q66HA2	0.599	0.598	3.200E-64	520	0.917	0.915	Q66HA2.pdb.gz	CR3L1_RAT Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Rattus norvegicus OX=10116 GN=Creb3l1 PE=2 SV=1
2	AFDB:Q6QDP7	0.352	0.351	1.122E-24	521	0.424	0.422	Q6QDP7.pdb.gz	CR3L2_RAT Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Rattus norvegicus OX=10116 GN=Creb3l2 PE=2 SV=1
3	AFDB:A1L224	0.335	0.335	3.083E-24	519	0.418	0.418	A1L224.pdb.gz	CR3L2_DANRE Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Danio rerio OX=7955 GN=creb3l2 PE=2 SV=1
4	AFDB:Q8TEY5	0.219	0.281	7.765E-10	395	0.206	0.271	Q8TEY5.pdb.gz	CR3L4_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Homo sapiens OX=9606 GN=CREB3L4 PE=1 SV=1
5	AFDB:Q61817	0.201	0.252	5.801E-8	404	0.225	0.290	Q61817.pdb.gz	CREB3_MOUSE Cyclic AMP-responsive element-binding protein 3 OS=Mus musculus OX=10090 GN=Creb3 PE=2 SV=2
6	AFDB:O44743	0.222	0.172	2.527E-6	690	0.233	0.175	O44743.pdb.gz	LE607_CAEEL CREB-H transcription factor homolog let-607 OS=Caenorhabditis elegans OX=6239 GN=let-607 PE=2 SV=2
7	AFDB:O35451	0.157	0.119	3.273E-5	699	0.214	0.159	O35451.pdb.gz	ATF6B_MOUSE Cyclic AMP-dependent transcription factor ATF-6 beta OS=Mus musculus OX=10090 GN=Atf6b PE=1 SV=1
8	AFDB:Q5RH85	0.132	0.111	5.246E-5	653	0.193	0.153	Q5RH85.pdb.gz	Q5RH85_DANRE Activating transcription factor 6 OS=Danio rerio OX=7955 GN=fi12h10 PE=4 SV=2
9	AFDB:P18850	0.154	0.122	2.160E-4	670	0.170	0.131	P18850.pdb.gz	ATF6A_HUMAN Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Homo sapiens OX=9606 GN=ATF6 PE=1 SV=3
10	AFDB:F6VAN0	0.123	0.102	6.351E-4	656	0.179	0.142	F6VAN0.pdb.gz	ATF6A_MOUSE Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Mus musculus OX=10090 GN=Atf6 PE=1 SV=2
11	PDB:7wi3B	0.138	0.223	5.786	275	0.042	0.080	7wi3B.pdb.gz
12	PDB:7abzZ	0.044	0.298	7.576	58	0.013	0.121	7abzZ.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
13	PDB:6v8oO	0.057	0.071	8.105	384	0.027	0.036	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
14	PDB:7mqaNA	0.045	0.075	8.105	295	0.039	0.068	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7pd3q	0.106	0.240	9.274	198	0.050	0.131	7pd3q.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q66HA2	0.0	863	520	0.913	0.912	CR3L1_RAT Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Rattus norvegicus OX=10116 GN=Creb3l1 PE=2 SV=1
2	Q96BA8	0.0	1060	519	1.000	1.000	CR3L1_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Homo sapiens OX=9606 GN=CREB3L1 PE=1 SV=1
3	Q9Z125	0.0	869	519	0.921	0.921	CR3L1_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Mus musculus OX=10090 GN=Creb3l1 PE=1 SV=2
4	Q70SY1	7.08e-92	291	520	0.416	0.415	CR3L2_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Homo sapiens OX=9606 GN=CREB3L2 PE=1 SV=3
5	A1L224	2.81e-88	282	519	0.405	0.405	CR3L2_DANRE Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Danio rerio OX=7955 GN=creb3l2 PE=2 SV=1
6	Q8BH52	5.88e-80	261	521	0.397	0.395	CR3L2_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Mus musculus OX=10090 GN=Creb3l2 PE=1 SV=1
7	Q6QDP7	1.68e-79	259	521	0.397	0.395	CR3L2_RAT Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Rattus norvegicus OX=10116 GN=Creb3l2 PE=2 SV=1
8	Q68CJ9	3.62e-33	133	461	0.127	0.143	CR3L3_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Homo sapiens OX=9606 GN=CREB3L3 PE=1 SV=2
9	Q8TEY5	2.16e-32	130	395	0.143	0.187	CR3L4_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Homo sapiens OX=9606 GN=CREB3L4 PE=1 SV=1
10	Q91XE9	7.19e-32	130	479	0.133	0.144	CR3L3_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Mus musculus OX=10090 GN=Creb3l3 PE=1 SV=1
11	P29747	2.03e-30	126	516	0.139	0.140	CREBA_DROME Cyclic AMP response element-binding protein A OS=Drosophila melanogaster OX=7227 GN=CrebA PE=1 SV=2
12	Q9D2A5	1.56e-29	121	370	0.131	0.184	CR3L4_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Mus musculus OX=10090 GN=Creb3l4 PE=1 SV=1
13	Q4JFH9	4.77e-29	119	351	0.108	0.160	CRH2_CAEEL CREB homolog crh-2 OS=Caenorhabditis elegans OX=6239 GN=crh-2 PE=2 SV=3
14	O43889	3.12e-28	117	371	0.125	0.175	CREB3_HUMAN Cyclic AMP-responsive element-binding protein 3 OS=Homo sapiens OX=9606 GN=CREB3 PE=1 SV=2
15	Q61817	1.70e-24	107	404	0.108	0.139	CREB3_MOUSE Cyclic AMP-responsive element-binding protein 3 OS=Mus musculus OX=10090 GN=Creb3 PE=2 SV=2
16	O44743	1.60e-16	85.1	690	0.110	0.083	LE607_CAEEL CREB-H transcription factor homolog let-607 OS=Caenorhabditis elegans OX=6239 GN=let-607 PE=2 SV=2
17	P15337	1.55e-09	61.6	327	0.067	0.107	CREB1_RAT Cyclic AMP-responsive element-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Creb1 PE=1 SV=2
18	Q9W618	1.76e-09	61.6	327	0.067	0.107	Q9W618_TAEGU CREB OS=Taeniopygia guttata OX=59729 PE=2 SV=1
19	Q01147	1.81e-09	61.6	327	0.067	0.107	CREB1_MOUSE Cyclic AMP-responsive element-binding protein 1 OS=Mus musculus OX=10090 GN=Creb1 PE=1 SV=2
20	P16220	2.02e-09	61.2	327	0.067	0.107	CREB1_HUMAN Cyclic AMP-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=CREB1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17675 APG6_N	3.8e+02	13.0	Apg6 coiled-coil region
2	PF00170 bZIP_1	1.4e-13	62.1	bZIP transcription factor
3	PF07716 bZIP_2	5.3e-05	34.5	Basic region leucine zipper
4	PF03131 bZIP_Maf	0.041	25.7	bZIP Maf transcription factor
5	PF14357 DUF4404	9.6e+02	11.8	Domain of unknown function (DUF4404)
6	PF09807 ELP6	1.7e+02	13.1	Elongation complex protein 6
7	PF15871 JMY	5e+02	11.4	Junction-mediating and -regulatory protein
8	PF09744 Jnk-SapK_ap_N	1.5e+02	14.1	JNK_SAPK-associated protein-1
9	PF04791 LMBR1	1.7	19.1	LMBR1-like membrane protein
10	PF05478 Prominin	4.1e+02	10.4	Prominin
11	PF12072 RNase_Y_N	2.2e+02	12.7	RNase Y N-terminal region
12	PF07926 TPR_MLP1_2	3e+02	12.8	TPR/MLP1/MLP2-like protein
13	PF20180 UQCC2_CBP6	3.9e+02	13.0	Complex III assembly factor UQCC2/CBP6

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481956

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344223	0.966	Membrane-bound transcription factor site-1 protease
2	9606.ENSP00000368798	0.966	Membrane-bound transcription factor site-2 protease
3	9606.ENSP00000078445	0.918	Cyclic AMP-responsive element-binding protein 3-like protein 3
4	9606.ENSP00000342136	0.884	Cyclic AMP-responsive element-binding protein 3
5	9606.ENSP00000336790	0.868	Cyclic AMP-dependent transcription factor ATF-4
6	9606.ENSP00000329140	0.858	Cyclic AMP-responsive element-binding protein 3-like protein 2
7	9606.ENSP00000357596	0.846	Cyclic AMP-responsive element-binding protein 3-like protein 4
8	9606.ENSP00000364349	0.843	Cyclic AMP-dependent transcription factor ATF-6 beta
9	9606.ENSP00000262367	0.840	CREB-binding protein
10	9606.ENSP00000387699	0.838	Cyclic AMP-responsive element-binding protein 1
11	9606.ENSP00000350359	0.825	Cyclic AMP-responsive element-binding protein 5
12	9606.ENSP00000263253	0.822	Histone acetyltransferase p300
13	9606.ENSP00000262053	0.810	Cyclic AMP-dependent transcription factor ATF-1
14	9606.ENSP00000264110	0.807	Cyclic AMP-dependent transcription factor ATF-2
15	9606.ENSP00000357622	0.806	CREB-regulated transcription coactivator 2
16	9606.ENSP00000280551	0.804	Protein transport protein Sec24D
17	9606.ENSP00000252996	0.800	Transcription initiation factor TFIID subunit 4
18	9606.ENSP00000269142	0.800	Transcription initiation factor TFIID subunit 4B
19	9606.ENSP00000324806	0.800	Glycogen synthase kinase-3 beta
20	9606.ENSP00000347184	0.800	Huntingtin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0005515	0.963	protein binding
GO:0000977	0.783	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001216	0.765	DNA-binding transcription activator activity
GO:0001228	0.726	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000987	0.418	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.392	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010468	0.989	regulation of gene expression
GO:0050896	0.987	response to stimulus
GO:0009987	0.987	cellular process
GO:0048518	0.986	positive regulation of biological process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0051716	0.984	cellular response to stimulus
GO:0009889	0.978	regulation of biosynthetic process
GO:0019219	0.975	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.966	regulation of DNA-templated transcription
GO:0009891	0.959	positive regulation of biosynthetic process
GO:0034976	0.951	response to endoplasmic reticulum stress
GO:0006357	0.948	regulation of transcription by RNA polymerase II
GO:0031325	0.938	positive regulation of cellular metabolic process
GO:0009968	0.935	negative regulation of signal transduction
GO:0045944	0.915	positive regulation of transcription by RNA polymerase II
GO:0080135	0.899	regulation of cellular response to stress
GO:1905897	0.806	regulation of response to endoplasmic reticulum stress
GO:1903573	0.649	negative regulation of response to endoplasmic reticulum stress
GO:0023052	0.639	signaling
GO:0007154	0.637	cell communication
GO:0007165	0.605	signal transduction
GO:0042221	0.528	response to chemical
GO:0010033	0.518	response to organic substance
GO:0036003	0.477	positive regulation of transcription from RNA polymerase II promoter in response to stress
GO:0051239	0.438	regulation of multicellular organismal process
GO:0071840	0.414	cellular component organization or biogenesis
GO:0008152	0.391	metabolic process
GO:0032501	0.377	multicellular organismal process
GO:0016043	0.372	cellular component organization
GO:0010941	0.368	regulation of cell death
GO:0071704	0.364	organic substance metabolic process
GO:0042981	0.349	regulation of apoptotic process
GO:0044238	0.327	primary metabolic process
GO:0032502	0.316	developmental process
GO:0070887	0.300	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0016020	0.999	membrane
GO:0005654	0.999	nucleoplasm
GO:0005829	0.998	cytosol
GO:0043228	0.965	non-membrane-bounded organelle
GO:0043232	0.963	intracellular non-membrane-bounded organelle
GO:0031090	0.960	organelle membrane
GO:0098588	0.901	bounding membrane of organelle
GO:0005794	0.869	Golgi apparatus
GO:0000785	0.747	chromatin
GO:0031984	0.415	organelle subcompartment
GO:0098827	0.406	endoplasmic reticulum subcompartment
GO:0005789	0.382	endoplasmic reticulum membrane
GO:0000139	0.328	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]