StarFunc result for job id Q96BD6

User Input

>input (273 residues)
MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNND
RSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATA
DAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVA
LDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDL
CRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96BD6	1.000	1.000	7.327E-65	273	1.000	1.000	Q96BD6.pdb.gz	SPSB1_HUMAN SPRY domain-containing SOCS box protein 1 OS=Homo sapiens OX=9606 GN=SPSB1 PE=1 SV=1
2	AFDB:A1Z6E0	0.907	0.887	9.069E-50	279	0.707	0.692	A1Z6E0.pdb.gz	GUS_DROME Protein gustavus OS=Drosophila melanogaster OX=7227 GN=gus PE=1 SV=2
3	AFDB:Q8R5B6	0.889	0.889	1.235E-49	273	0.747	0.747	Q8R5B6.pdb.gz	SPSB4_MOUSE SPRY domain-containing SOCS box protein 4 OS=Mus musculus OX=10090 GN=Spsb4 PE=1 SV=1
4	AFDB:O88838	0.866	0.894	3.607E-37	264	0.513	0.530	O88838.pdb.gz	SPSB2_MOUSE SPRY domain-containing SOCS box protein 2 OS=Mus musculus OX=10090 GN=Spsb2 PE=1 SV=1
5	AFDB:Q9V6L9	0.620	0.662	1.953E-24	255	0.315	0.337	Q9V6L9.pdb.gz	FBSP1_DROME F-box/SPRY domain-containing protein 1 OS=Drosophila melanogaster OX=7227 GN=Fsn PE=1 SV=1
6	AFDB:P0C2W1	0.624	0.597	6.310E-24	286	0.289	0.276	P0C2W1.pdb.gz	FBSP1_HUMAN F-box/SPRY domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FBXO45 PE=1 SV=1
7	AFDB:Q18223	0.623	0.515	2.169E-23	332	0.275	0.226	Q18223.pdb.gz	FBSP1_CAEEL F-box/SPRY domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=fsn-1 PE=1 SV=1
8	AFDB:Q6PJ21	0.625	0.490	1.938E-17	355	0.201	0.155	Q6PJ21.pdb.gz	SPSB3_HUMAN SPRY domain-containing SOCS box protein 3 OS=Homo sapiens OX=9606 GN=SPSB3 PE=1 SV=2
9	AFDB:Q8C7M3	0.485	0.173	1.691E-13	817	0.150	0.050	Q8C7M3.pdb.gz	TRIM9_MOUSE E3 ubiquitin-protein ligase TRIM9 OS=Mus musculus OX=10090 GN=Trim9 PE=1 SV=2
10	AFDB:Q91ZY8	0.505	0.206	9.523E-13	710	0.139	0.054	Q91ZY8.pdb.gz	TRIM9_RAT E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1
11	PDB:7nscA	0.524	0.519	2.945E-12	276	0.165	0.163	7nscA.pdb.gz
12	PDB:7ccbA	0.460	0.732	4.289E-9	164	0.103	0.171	7ccbA.pdb.gz
13	PDB:7ua3A	0.401	0.028	1.887E-8	4443	0.084	0.005	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
14	PDB:6swy1	0.447	0.243	5.388E-8	542	0.121	0.061	6swy1.pdb.gz
15	PDB:6venO	0.464	0.407	1.637E-7	315	0.136	0.117	6venO.pdb.gz	Structural basis for COMPASS recognition of an H2B-ubiquitinated nucleosome.
16	PDB:7y4sA	0.437	0.358	1.970E-7	343	0.136	0.108	7y4sA.pdb.gz
17	PDB:7u9tA	0.401	0.029	2.228E-7	4229	0.084	0.005	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
18	PDB:7tzcA	0.394	0.027	5.983E-7	4404	0.081	0.005	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
19	PDB:7m6aA	0.368	0.026	6.364E-7	4306	0.081	0.005	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
20	PDB:6wotA	0.387	0.028	1.709E-6	4197	0.099	0.006	6wotA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96BD6	0.0	565	273	1.000	1.000	SPSB1_HUMAN SPRY domain-containing SOCS box protein 1 OS=Homo sapiens OX=9606 GN=SPSB1 PE=1 SV=1
2	Q9D5L7	0.0	556	273	0.985	0.985	SPSB1_MOUSE SPRY domain-containing SOCS box protein 1 OS=Mus musculus OX=10090 GN=Spsb1 PE=1 SV=1
3	Q96A44	3.02e-155	435	273	0.747	0.747	SPSB4_HUMAN SPRY domain-containing SOCS box protein 4 OS=Homo sapiens OX=9606 GN=SPSB4 PE=1 SV=1
4	Q8R5B6	1.56e-154	433	273	0.747	0.747	SPSB4_MOUSE SPRY domain-containing SOCS box protein 4 OS=Mus musculus OX=10090 GN=Spsb4 PE=1 SV=1
5	A1Z6E0	2.71e-145	410	279	0.714	0.699	GUS_DROME Protein gustavus OS=Drosophila melanogaster OX=7227 GN=gus PE=1 SV=2
6	O88838	7.20e-88	264	264	0.502	0.519	SPSB2_MOUSE SPRY domain-containing SOCS box protein 2 OS=Mus musculus OX=10090 GN=Spsb2 PE=1 SV=1
7	Q99619	6.10e-87	261	263	0.480	0.498	SPSB2_HUMAN SPRY domain-containing SOCS box protein 2 OS=Homo sapiens OX=9606 GN=SPSB2 PE=1 SV=1
8	Q9V6L9	7.50e-45	154	255	0.300	0.322	FBSP1_DROME F-box/SPRY domain-containing protein 1 OS=Drosophila melanogaster OX=7227 GN=Fsn PE=1 SV=1
9	Q8K3B1	2.57e-41	145	286	0.278	0.266	FBSP1_MOUSE F-box/SPRY domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fbxo45 PE=1 SV=2
10	P0C2W1	6.29e-41	144	286	0.275	0.262	FBSP1_HUMAN F-box/SPRY domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FBXO45 PE=1 SV=1
11	Q18223	2.14e-34	128	332	0.253	0.208	FBSP1_CAEEL F-box/SPRY domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=fsn-1 PE=1 SV=1
12	Q6PJ21	3.63e-10	62.0	355	0.209	0.161	SPSB3_HUMAN SPRY domain-containing SOCS box protein 3 OS=Homo sapiens OX=9606 GN=SPSB3 PE=1 SV=2
13	M9MRI4	9.57e-05	45.8	740	0.154	0.057	TRIM9_DROME E3 ubiquitin-protein ligase TRIM9 OS=Drosophila melanogaster OX=7227 GN=Trim9 PE=1 SV=1
14	Q8BNK4	7.47e-04	42.7	367	0.121	0.090	Q8BNK4_MOUSE B30.2/SPRY domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Herc1 PE=2 SV=1
15	Q8C7M3	7.63e-04	43.1	817	0.117	0.039	TRIM9_MOUSE E3 ubiquitin-protein ligase TRIM9 OS=Mus musculus OX=10090 GN=Trim9 PE=1 SV=2
16	Q91ZY8	8.24e-04	43.1	710	0.117	0.045	TRIM9_RAT E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1
17	E9PZP8	8.86e-04	43.1	4859	0.121	0.007	E9PZP8_MOUSE HECT and RLD domain containing E3 ubiquitin protein ligase family member 1 OS=Mus musculus OX=10090 GN=Herc1 PE=1 SV=1
18	Q15751	0.001	43.1	4861	0.121	0.007	HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2
19	C9J266	0.002	41.6	762	0.095	0.034	C9J266_HUMAN Ring finger protein 123 OS=Homo sapiens OX=9606 GN=RNF123 PE=1 SV=1
20	Q5XPI4	0.002	42.0	1314	0.095	0.020	RN123_HUMAN E3 ubiquitin-protein ligase RNF123 OS=Homo sapiens OX=9606 GN=RNF123 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07525 SOCS_box	5.6e-07	41.1	SOCS box
2	PF00622 SPRY	8.2e-16	69.6	SPRY domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330221

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328088	0.940	PRKC apoptosis WT1 regulator protein
2	9606.ENSP00000262306	0.898	Elongin-B
3	9606.ENSP00000478121	0.894	Elongin-C
4	9606.ENSP00000376808	0.822	Cullin-5
5	9606.ENSP00000317272	0.802	Hepatocyte growth factor receptor
6	9606.ENSP00000409346	0.764	Cytokine-inducible SH2-containing protein
7	9606.ENSP00000327251	0.763	Nitric oxide synthase, inducible
8	9606.ENSP00000273480	0.748	RING-box protein 2
9	9606.ENSP00000444596	0.727	E3 ubiquitin-protein ligase MYCBP2
10	9606.ENSP00000274376	0.724	Ras GTPase-activating protein 1
11	9606.ENSP00000349291	0.706	TBC1 domain family member 9B
12	9606.ENSP00000363763	0.642	Ephrin type-B receptor 2
13	9606.ENSP00000359264	0.630	Breast cancer anti-estrogen resistance protein 3
14	9606.ENSP00000250495	0.625	NEDD8
15	9606.ENSP00000365401	0.610	Coiled-coil domain-containing protein 22
16	9606.ENSP00000366032	0.608	COMM domain-containing protein 3
17	9606.ENSP00000394331	0.608	COMM domain-containing protein 5
18	9606.ENSP00000278980	0.606	COMM domain-containing protein 7
19	9606.ENSP00000263401	0.600	COMM domain-containing protein 9
20	9606.ENSP00000267935	0.600	COMM domain-containing protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140767	0.521	enzyme-substrate adaptor activity
GO:1990756	0.513	ubiquitin ligase-substrate adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0070647	0.992	protein modification by small protein conjugation or removal
GO:0043632	0.989	modification-dependent macromolecule catabolic process
GO:0016567	0.945	protein ubiquitination
GO:0051603	0.925	proteolysis involved in protein catabolic process
GO:0006511	0.922	ubiquitin-dependent protein catabolic process
GO:0065007	0.808	biological regulation
GO:0050789	0.800	regulation of biological process
GO:0050794	0.577	regulation of cellular process
GO:0019222	0.447	regulation of metabolic process
GO:0060255	0.362	regulation of macromolecule metabolic process
GO:0048518	0.340	positive regulation of biological process
GO:0080090	0.324	regulation of primary metabolic process
GO:0051171	0.323	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0070013	0.877	intracellular organelle lumen
GO:0005634	0.725	nucleus
GO:0031981	0.497	nuclear lumen
GO:0005654	0.371	nucleoplasm
GO:0032991	0.326	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]