StarFunc result for job id Q96BF3

User Input

>input (282 residues)
MGSPGMVLGLLVQIWALQEASSLSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWT
KDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPE
LEEAEGNITRLFVDPDDPTQNRNRIASFPGFLFVLLGVGSMGVAAIVWGAWFWGRRSCQQ
RDSGNSPGNAFYSNVLYRPRGAPKKSEDCSGEGKDQRGQSIYSTSFPQPAPRQPHLASRP
CPSPRPCPSPRPGHPVSMVRVSPRPSPTQQPRPKGFPKVGEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96BF3	1.000	1.000	2.177E-47	282	1.000	1.000	Q96BF3.pdb.gz	TMIG2_HUMAN Transmembrane and immunoglobulin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TMIGD2 PE=1 SV=2
2	AFDB:Q02242	0.362	0.356	6.235E-11	288	0.202	0.198	Q02242.pdb.gz	PDCD1_MOUSE Programmed cell death protein 1 OS=Mus musculus OX=10090 GN=Pdcd1 PE=1 SV=1
3	AFDB:Q15116	0.354	0.347	9.704E-11	288	0.184	0.181	Q15116.pdb.gz	PDCD1_HUMAN Programmed cell death protein 1 OS=Homo sapiens OX=9606 GN=PDCD1 PE=1 SV=3
4	AFDB:D3ZIN8	0.349	0.344	1.279E-10	287	0.195	0.192	D3ZIN8.pdb.gz	D3ZIN8_RAT Programmed cell death 1 OS=Rattus norvegicus OX=10116 GN=Pdcd1 PE=4 SV=1
5	AFDB:Q8TDQ1	0.321	0.314	1.010E-8	290	0.138	0.134	Q8TDQ1.pdb.gz	CLM1_HUMAN CMRF35-like molecule 1 OS=Homo sapiens OX=9606 GN=CD300LF PE=1 SV=3
6	AFDB:A0A2R8RYG1	0.284	0.190	1.572E-8	442	0.177	0.113	A0A2R8RYG1.pdb.gz
7	AFDB:Q7Z692	0.319	0.303	2.073E-8	300	0.177	0.167	Q7Z692.pdb.gz	CEA19_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 19 OS=Homo sapiens OX=9606 GN=CEACAM19 PE=2 SV=2
8	AFDB:P0C673	0.290	0.202	2.447E-8	428	0.195	0.129	P0C673.pdb.gz	IGS11_MOUSE Immunoglobulin superfamily member 11 OS=Mus musculus OX=10090 GN=Igsf11 PE=1 SV=1
9	AFDB:B0CLV1	0.283	0.201	4.495E-8	428	0.199	0.131	B0CLV1.pdb.gz	B0CLV1_DANRE Endothelial cell-selective adhesion molecule precursor OS=Danio rerio OX=7955 GN=ESAM PE=2 SV=1
10	AFDB:Q15762	0.310	0.268	4.495E-8	336	0.160	0.134	Q15762.pdb.gz	CD226_HUMAN CD226 antigen OS=Homo sapiens OX=9606 GN=CD226 PE=1 SV=2
11	PDB:5hhmI	0.312	0.433	9.188E-8	196	0.078	0.112	5hhmI.pdb.gz	Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
12	PDB:4m62L	0.307	0.684	1.511E-7	113	0.089	0.221	4m62L.pdb.gz
13	PDB:1f11A	0.312	0.397	2.106E-7	216	0.099	0.130	1f11A.pdb.gz
14	PDB:1k4dB	0.310	0.401	2.352E-7	212	0.078	0.104	1k4dB.pdb.gz
15	PDB:1ct8A	0.311	0.397	2.935E-7	214	0.099	0.131	1ct8A.pdb.gz	Diverse structural solutions to catalysis in a family of antibodies.
16	PDB:1i7zA	0.310	0.390	3.102E-7	219	0.096	0.123	1i7zA.pdb.gz	Crystal structure of a cocaine-binding antibody.
17	PDB:1cd0A	0.284	0.649	3.661E-7	111	0.064	0.162	1cd0A.pdb.gz
18	PDB:2cd0A	0.299	0.691	4.322E-7	111	0.053	0.135	2cd0A.pdb.gz
19	PDB:4d3cL	0.295	0.383	5.392E-7	209	0.078	0.105	4d3cL.pdb.gz
20	PDB:6hd8A	0.312	0.199	5.699E-7	461	0.071	0.043	6hd8A.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96BF3	0.0	572	282	1.000	1.000	TMIG2_HUMAN Transmembrane and immunoglobulin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TMIGD2 PE=1 SV=2
2	O75147	0.15	36.2	1896	0.085	0.013	OBSL1_HUMAN Obscurin-like protein 1 OS=Homo sapiens OX=9606 GN=OBSL1 PE=1 SV=4
3	Q9JKA5	0.16	35.4	319	0.099	0.088	GPA33_MOUSE Cell surface A33 antigen OS=Mus musculus OX=10090 GN=Gpa33 PE=2 SV=2
4	Q59DZ4	0.28	35.0	410	0.163	0.112	Q59DZ4_DROME Defective proboscis extension response 2, isoform F OS=Drosophila melanogaster OX=7227 GN=dpr2 PE=1 SV=4
5	G5EBF1	0.37	35.0	1273	0.145	0.032	SAX3_CAEEL Protein sax-3 OS=Caenorhabditis elegans OX=6239 GN=sax-3 PE=2 SV=1
6	Q9SJ84	0.47	34.3	652	0.064	0.028	FIMB4_ARATH Fimbrin-4 OS=Arabidopsis thaliana OX=3702 GN=FIM4 PE=3 SV=1
7	O97267	0.65	34.3	2114	0.057	0.008	O97267_PLAF7 Circumsporozoite- and TRAP-related protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0315200 PE=4 SV=1
8	A0A8I6B4D6	0.74	33.9	1283	0.078	0.017	A0A8I6B4D6_RAT SOS Ras/Rac guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Sos1 PE=1 SV=1
9	A0A494C054	0.83	32.3	155	0.089	0.161	A0A494C054_HUMAN Neuregulin 1 (Fragment) OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=1
10	D4A3T0	0.84	33.9	1319	0.078	0.017	D4A3T0_RAT SOS Ras/Rac guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Sos1 PE=1 SV=2
11	Q8WZ42	0.88	33.9	34350	0.057	0.000	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
12	Q07889	0.92	33.5	1333	0.078	0.017	SOS1_HUMAN Son of sevenless homolog 1 OS=Homo sapiens OX=9606 GN=SOS1 PE=1 SV=1
13	Q62245	0.92	33.5	1319	0.078	0.017	SOS1_MOUSE Son of sevenless homolog 1 OS=Mus musculus OX=10090 GN=Sos1 PE=1 SV=2
14	A0A8I6A999	1.0	33.5	1193	0.078	0.018	A0A8I6A999_RAT Rpgrip1-like OS=Rattus norvegicus OX=10116 GN=Rpgrip1l PE=3 SV=1
15	A0A494C114	1.1	32.7	207	0.089	0.121	A0A494C114_HUMAN Neuregulin 1 OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=1
16	D3Z8G3	1.1	33.5	1268	0.078	0.017	D3Z8G3_RAT Rpgrip1-like OS=Rattus norvegicus OX=10116 GN=Rpgrip1l PE=3 SV=2
17	G1TRT1	1.2	33.1	1304	0.078	0.017	G1TRT1_RABIT SOS Ras/Rac guanine nucleotide exchange factor 1 OS=Oryctolagus cuniculus OX=9986 GN=SOS1 PE=4 SV=2
18	Q6PK61	1.4	32.3	241	0.089	0.104	Q6PK61_HUMAN Neuregulin 1 OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=1
19	D3ZZ80	1.5	33.1	1805	0.060	0.009	OBSL1_RAT Obscurin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Obsl1 PE=2 SV=3
20	A0A494C1G2	1.8	32.3	387	0.089	0.065	A0A494C1G2_HUMAN Neuregulin 1 (Fragment) OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	0.075	24.4	Immunoglobulin I-set domain
2	PF00047 ig	16	17.1	Immunoglobulin domain
3	PF13895 Ig_2	0.17	23.5	Immunoglobulin domain
4	PF13927 Ig_3	0.001	30.9	Immunoglobulin domain
5	PF18452 Ig_6	5.7e+02	11.8	Immunoglobulin domain
6	PF16031 TonB_N	4.8e+02	12.7	TonB polyproline region
7	PF07686 V-set	0.0022	29.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301272

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350402	0.979	HERV-H LTR-associating protein 2
2	9606.ENSP00000264246	0.823	T-lymphocyte activation antigen CD80
3	9606.ENSP00000303939	0.745	Cytotoxic T-lymphocyte protein 4
4	9606.ENSP00000294129	0.742	NCK-interacting protein with SH3 domain
5	9606.ENSP00000320084	0.659	CD276 antigen
6	9606.ENSP00000319476	0.567	Inducible T-cell costimulator
7	9606.ENSP00000358470	0.563	V-set domain-containing T-cell activation inhibitor 1
8	9606.ENSP00000332049	0.559	T-lymphocyte activation antigen CD86
9	9606.ENSP00000324890	0.515	T-cell-specific surface glycoprotein CD28
10	9606.ENSP00000380855	0.509	Programmed cell death 1 ligand 2
11	9606.ENSP00000339477	0.504	Inducible T-cell co-stimulator ligand
12	9606.ENSP00000483732	0.504	ICOS ligand
13	9606.ENSP00000370989	0.503	Programmed cell death 1 ligand 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015026	1.000	coreceptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0001817	0.996	regulation of cytokine production
GO:0051240	0.995	positive regulation of multicellular organismal process
GO:0048522	0.995	positive regulation of cellular process
GO:1903037	0.995	regulation of leukocyte cell-cell adhesion
GO:0042129	0.995	regulation of T cell proliferation
GO:0010604	0.993	positive regulation of macromolecule metabolic process
GO:0051251	0.993	positive regulation of lymphocyte activation
GO:0046006	0.984	regulation of activated T cell proliferation
GO:0042102	0.984	positive regulation of T cell proliferation
GO:0001819	0.983	positive regulation of cytokine production
GO:0002376	0.969	immune system process
GO:2000026	0.964	regulation of multicellular organismal development
GO:1901342	0.910	regulation of vasculature development
GO:0051094	0.846	positive regulation of developmental process
GO:0022603	0.708	regulation of anatomical structure morphogenesis
GO:0045765	0.651	regulation of angiogenesis
GO:1904018	0.586	positive regulation of vasculature development
GO:0048519	0.488	negative regulation of biological process
GO:0002683	0.483	negative regulation of immune system process
GO:0048523	0.464	negative regulation of cellular process
GO:0009987	0.463	cellular process
GO:0051250	0.446	negative regulation of lymphocyte activation
GO:0050868	0.443	negative regulation of T cell activation
GO:0031295	0.440	T cell costimulation
GO:0050896	0.391	response to stimulus
GO:0042104	0.367	positive regulation of activated T cell proliferation
GO:0045766	0.309	positive regulation of angiogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005737	0.993	cytoplasm
GO:0043231	0.987	intracellular membrane-bounded organelle
GO:0009986	0.977	cell surface
GO:0009897	0.941	external side of plasma membrane
GO:0031982	0.819	vesicle
GO:0012505	0.592	endomembrane system
GO:0005576	0.446	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]