StarFunc result for job id Q96BF6

User Input

>input (587 residues)
MSQMLHIEIPNFGNTVLGCLNEQRLLGLYCDVSIVVKGQAFKAHRAVLAASSLYFRDLFS
GNSKSAFELPGSVPPACFQQILSFCYTGRLTMTASEQLVVMYTAGFLQIQHIVERGTDLM
FKVSSPHCDSQTAVIEDAGSEPQSPCNQLQPAAAAAAPYVVSPSVPIPLLTRVKHEAMEL
PPAGPGLAPKRPLETGPRDGVAVAAGAAVAAGTAPLKLPRVSYYGVPSLATLIPGIQQMP
YPQGERTSPGASSLPTTDSPTSYHNEEDEEDDEAYDTMVEEQYGQMYIKASGSYAVQEKP
EPVPLESRSCVLIRRDLVALPASLISQIGYRCHPKLYSEGDPGEKLELVAGSGVYITRGQ
LMNCHLCAGVKHKVLLRRLLATFFDRNTLANSCGTGIRSSTSDPSRKPLDSRVLNAVKLY
CQNFAPSFKESEMNVIAADMCTNARRVRKRWLPKIKSMLPEGVEMYRTVMGSAAASVPLD
PEFPPAAAQVFEQRIYAERRGDAATIVALRTDAVNVDLSAAANPAFDAGEEVDGAGSVIQ
EVAAPEPLPADGQSPPQPFEQGGGGPSRPQTPAAAARRPEGTYAGTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R8I0	0.417	0.417	2.842E-80	587	1.000	1.000	A0A024R8I0.pdb.gz
2	AFDB:A0A024R7E0	0.239	0.262	1.294E-42	527	0.474	0.528	A0A024R7E0.pdb.gz
3	AFDB:O35260	0.250	0.282	3.057E-41	514	0.465	0.531	O35260.pdb.gz	NACC1_RAT Nucleus accumbens-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Nacc1 PE=1 SV=1
4	AFDB:O43298	0.214	0.266	1.696E-12	467	0.177	0.223	O43298.pdb.gz	ZBT43_HUMAN Zinc finger and BTB domain-containing protein 43 OS=Homo sapiens OX=9606 GN=ZBTB43 PE=1 SV=1
5	AFDB:Q5TC79	0.207	0.240	3.404E-12	503	0.187	0.219	Q5TC79.pdb.gz	ZBT37_HUMAN Zinc finger and BTB domain-containing protein 37 OS=Homo sapiens OX=9606 GN=ZBTB37 PE=2 SV=1
6	AFDB:Q96C00	0.211	0.260	4.459E-11	473	0.131	0.163	Q96C00.pdb.gz	ZBTB9_HUMAN Zinc finger and BTB domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZBTB9 PE=1 SV=1
7	AFDB:P17789	0.190	0.174	6.150E-11	643	0.143	0.131	P17789.pdb.gz	TTKB_DROME Protein tramtrack, beta isoform OS=Drosophila melanogaster OX=7227 GN=ttk PE=1 SV=2
8	AFDB:Q8BID6	0.204	0.200	7.620E-11	600	0.182	0.178	Q8BID6.pdb.gz	ZBT46_MOUSE Zinc finger and BTB domain-containing protein 46 OS=Mus musculus OX=10090 GN=Zbtb46 PE=1 SV=2
9	AFDB:Q96BR9	0.198	0.257	1.234E-10	441	0.179	0.238	Q96BR9.pdb.gz	ZBT8A_HUMAN Zinc finger and BTB domain-containing protein 8A OS=Homo sapiens OX=9606 GN=ZBTB8A PE=1 SV=3
10	AFDB:A0A023PGP0	0.200	0.186	1.302E-10	632	0.187	0.174	A0A023PGP0.pdb.gz
11	PDB:6wcqC	0.184	0.789	1.211E-6	130	0.058	0.262	6wcqC.pdb.gz
12	PDB:7mk2A	0.163	0.259	1.680E-3	354	0.048	0.079	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
13	PDB:6sgaFS	0.110	0.217	3.035E-2	277	0.039	0.083	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
14	PDB:7f3fA	0.123	0.152	4.917E-2	460	0.034	0.043	7f3fA.pdb.gz
15	PDB:7w6sB	0.118	0.150	9.868E-2	448	0.032	0.042	7w6sB.pdb.gz
16	PDB:6gypD	0.147	0.532	1.041E-1	151	0.024	0.093	6gypD.pdb.gz	Architecture of the CBF3-centromere complex of the budding yeast kinetochore.
17	PDB:3ogkA	0.150	0.564	2.090E-1	145	0.020	0.083	3ogkA.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
18	PDB:2a79B	0.110	0.225	4.425E-1	259	0.037	0.085	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
19	PDB:3lutB	0.129	0.182	8.419E-1	390	0.029	0.044	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
20	PDB:6kvgA	0.061	0.104	9.371E-1	256	0.032	0.074	6kvgA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96BF6	0.0	1201	587	1.000	1.000	NACC2_HUMAN Nucleus accumbens-associated protein 2 OS=Homo sapiens OX=9606 GN=NACC2 PE=1 SV=1
2	Q7TSZ8	5.59e-168	489	514	0.474	0.541	NACC1_MOUSE Nucleus accumbens-associated protein 1 OS=Mus musculus OX=10090 GN=Nacc1 PE=1 SV=1
3	O35260	3.63e-166	484	514	0.468	0.535	NACC1_RAT Nucleus accumbens-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Nacc1 PE=1 SV=1
4	Q96RE7	5.20e-166	485	527	0.472	0.526	NACC1_HUMAN Nucleus accumbens-associated protein 1 OS=Homo sapiens OX=9606 GN=NACC1 PE=1 SV=1
5	Q5TC79	2.12e-27	118	503	0.092	0.107	ZBT37_HUMAN Zinc finger and BTB domain-containing protein 37 OS=Homo sapiens OX=9606 GN=ZBTB37 PE=2 SV=1
6	A0A0C4DFQ2	1.05e-23	107	504	0.102	0.119	A0A0C4DFQ2_HUMAN Zinc finger and BTB domain containing 34 OS=Homo sapiens OX=9606 GN=ZBTB34 PE=1 SV=1
7	Q8NCN2	1.12e-23	107	500	0.102	0.120	ZBT34_HUMAN Zinc finger and BTB domain-containing protein 34 OS=Homo sapiens OX=9606 GN=ZBTB34 PE=1 SV=4
8	O15209	2.41e-22	103	634	0.083	0.077	ZBT22_HUMAN Zinc finger and BTB domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZBTB22 PE=1 SV=1
9	O43298	5.74e-22	101	467	0.089	0.111	ZBT43_HUMAN Zinc finger and BTB domain-containing protein 43 OS=Homo sapiens OX=9606 GN=ZBTB43 PE=1 SV=1
10	Q9HC78	9.42e-18	89.4	741	0.080	0.063	ZBT20_HUMAN Zinc finger and BTB domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZBTB20 PE=1 SV=3
11	Q8K0L9	1.01e-17	89.4	741	0.080	0.063	ZBT20_MOUSE Zinc finger and BTB domain-containing protein 20 OS=Mus musculus OX=10090 GN=Zbtb20 PE=1 SV=1
12	Q96K62	1.90e-17	87.8	511	0.075	0.086	ZBT45_HUMAN Zinc finger and BTB domain-containing protein 45 OS=Homo sapiens OX=9606 GN=ZBTB45 PE=1 SV=1
13	Q96BR9	3.88e-17	86.3	441	0.078	0.104	ZBT8A_HUMAN Zinc finger and BTB domain-containing protein 8A OS=Homo sapiens OX=9606 GN=ZBTB8A PE=1 SV=3
14	Q8VCZ7	5.81e-17	86.7	619	0.085	0.081	ZBT7C_MOUSE Zinc finger and BTB domain-containing protein 7C OS=Mus musculus OX=10090 GN=Zbtb7c PE=2 SV=1
15	A1YPR0	6.95e-16	83.2	619	0.082	0.078	ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens OX=9606 GN=ZBTB7C PE=2 SV=1
16	Q9HCK0	4.81e-15	80.1	441	0.085	0.113	ZBT26_HUMAN Zinc finger and BTB domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ZBTB26 PE=1 SV=2
17	Q60821	8.30e-15	80.1	794	0.080	0.059	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2
18	Q86UZ6	1.41e-14	79.0	589	0.073	0.073	ZBT46_HUMAN Zinc finger and BTB domain-containing protein 46 OS=Homo sapiens OX=9606 GN=ZBTB46 PE=1 SV=2
19	Q13105	1.59e-14	79.3	803	0.078	0.057	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
20	Q96C00	2.87e-14	77.8	473	0.065	0.080	ZBTB9_HUMAN Zinc finger and BTB domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZBTB9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10523 BEN	9.5e-05	33.9	BEN domain
2	PF00651 BTB	8.2e-20	82.5	BTB/POZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000277554

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349274	0.557	Protein phosphatase 1 regulatory subunit 26
2	9606.ENSP00000355094	0.531	Protein quaking
3	9606.ENSP00000318085	0.519	Histone H4 transcription factor
4	9606.ENSP00000359782	0.519	BEN domain-containing protein 6
5	9606.ENSP00000319974	0.518	HMG box transcription factor BBX
6	9606.ENSP00000345773	0.518	BEN domain containing 7
7	9606.ENSP00000378402	0.500	Paired amphipathic helix protein Sin3a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.997	DNA binding
GO:0043565	0.973	sequence-specific DNA binding
GO:0140110	0.774	transcription regulator activity
GO:0042802	0.503	identical protein binding
GO:0003700	0.496	DNA-binding transcription factor activity
GO:0003690	0.436	double-stranded DNA binding
GO:1990837	0.380	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.997	regulation of macromolecule metabolic process
GO:0048519	0.996	negative regulation of biological process
GO:0080090	0.996	regulation of primary metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0010468	0.990	regulation of gene expression
GO:2001141	0.985	regulation of RNA biosynthetic process
GO:0006355	0.980	regulation of DNA-templated transcription
GO:0010605	0.978	negative regulation of macromolecule metabolic process
GO:0048523	0.977	negative regulation of cellular process
GO:0009987	0.972	cellular process
GO:0031324	0.946	negative regulation of cellular metabolic process
GO:0045892	0.943	negative regulation of DNA-templated transcription
GO:0048518	0.904	positive regulation of biological process
GO:0048522	0.784	positive regulation of cellular process
GO:0006357	0.687	regulation of transcription by RNA polymerase II
GO:0071840	0.663	cellular component organization or biogenesis
GO:0016043	0.645	cellular component organization
GO:0000122	0.634	negative regulation of transcription by RNA polymerase II
GO:0048583	0.434	regulation of response to stimulus
GO:0042127	0.390	regulation of cell population proliferation
GO:0051726	0.373	regulation of cell cycle
GO:0008285	0.342	negative regulation of cell population proliferation
GO:0010564	0.340	regulation of cell cycle process
GO:0045786	0.325	negative regulation of cell cycle
GO:0023051	0.320	regulation of signaling
GO:0010646	0.320	regulation of cell communication
GO:1901987	0.320	regulation of cell cycle phase transition
GO:0050896	0.311	response to stimulus
GO:0071704	0.310	organic substance metabolic process
GO:0042981	0.302	regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0031981	1.000	nuclear lumen
GO:0005730	0.988	nucleolus
GO:0005654	0.968	nucleoplasm
GO:0005739	0.960	mitochondrion
GO:0005694	0.926	chromosome
GO:0000785	0.806	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]