StarFunc result for job id Q96BJ3

User Input

>input (306 residues)
MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQK
KTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRI
LAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKD
AGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIF
FEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLH
QTLHKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96BJ3	1.000	1.000	3.086E-61	306	1.000	1.000	Q96BJ3.pdb.gz	AIDA_HUMAN Axin interactor, dorsalization-associated protein OS=Homo sapiens OX=9606 GN=AIDA PE=1 SV=1
2	AFDB:Q6PBN2	0.919	0.928	1.132E-52	303	0.827	0.835	Q6PBN2.pdb.gz	AIDA_DANRE Axin interactor, dorsalization-associated protein OS=Danio rerio OX=7955 GN=aida PE=1 SV=1
3	AFDB:Q96LX7	0.349	0.180	4.882E-7	622	0.134	0.066	Q96LX7.pdb.gz	CCD17_HUMAN Coiled-coil domain-containing protein 17 OS=Homo sapiens OX=9606 GN=CCDC17 PE=1 SV=2
4	AFDB:Q6DTM3	0.362	0.116	5.170E-7	1047	0.147	0.043	Q6DTM3.pdb.gz	AHI1_RAT Jouberin OS=Rattus norvegicus OX=10116 GN=Ahi1 PE=1 SV=1
5	AFDB:O70173	0.359	0.080	6.886E-7	1505	0.114	0.023	O70173.pdb.gz	P3C2G_RAT Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma OS=Rattus norvegicus OX=10116 GN=Pik3c2g PE=1 SV=1
6	AFDB:O70167	0.379	0.086	2.046E-6	1506	0.118	0.024	O70167.pdb.gz	P3C2G_MOUSE Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma OS=Mus musculus OX=10090 GN=Pik3c2g PE=1 SV=1
7	AFDB:F8W3V6	0.310	0.092	2.574E-6	1193	0.114	0.029	F8W3V6.pdb.gz
8	AFDB:O00443	0.325	0.068	2.726E-6	1686	0.085	0.015	O00443.pdb.gz	P3C2A_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=2
9	AFDB:O00750	0.374	0.077	2.726E-6	1634	0.131	0.024	O00750.pdb.gz	P3C2B_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta OS=Homo sapiens OX=9606 GN=PIK3C2B PE=1 SV=2
10	AFDB:Q6ZW31	0.284	0.132	4.312E-6	735	0.101	0.042	Q6ZW31.pdb.gz	SYDE1_HUMAN Rho GTPase-activating protein SYDE1 OS=Homo sapiens OX=9606 GN=SYDE1 PE=1 SV=1
11	PDB:5itdA	0.327	0.113	7.747E-5	995	0.059	0.018	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
12	PDB:5dxhD	0.311	0.108	8.204E-5	981	0.059	0.018	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
13	PDB:6pyuA	0.345	0.122	1.939E-4	930	0.052	0.017	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
14	PDB:7lq1A	0.341	0.120	2.582E-4	950	0.059	0.019	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
15	PDB:4yknA	0.330	0.093	4.851E-4	1205	0.059	0.015	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
16	PDB:5swpA	0.344	0.107	4.851E-4	1060	0.052	0.015	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
17	PDB:5a52A	0.262	0.475	6.842E-4	154	0.082	0.162	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:7mezA	0.342	0.117	6.842E-4	989	0.062	0.019	7mezA.pdb.gz
19	PDB:7jvxA	0.260	0.255	9.651E-4	314	0.082	0.080	7jvxA.pdb.gz
20	PDB:4rj9A	0.288	0.502	1.214E-3	161	0.065	0.124	4rj9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PBN2	0.0	525	303	0.827	0.835	AIDA_DANRE Axin interactor, dorsalization-associated protein OS=Danio rerio OX=7955 GN=aida PE=1 SV=1
2	Q8C4Q6	0.0	612	305	0.977	0.980	AIDA_MOUSE Axin interactor, dorsalization-associated protein OS=Mus musculus OX=10090 GN=Aida PE=1 SV=1
3	Q96BJ3	0.0	628	306	1.000	1.000	AIDA_HUMAN Axin interactor, dorsalization-associated protein OS=Homo sapiens OX=9606 GN=AIDA PE=1 SV=1
4	P35187	6.8	31.2	1447	0.101	0.021	SGS1_YEAST ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGS1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14186 Aida_C2	8.6e-61	215.3	Axin interactor dorsalisation-associated protein, C-terminal
2	PF08910 Aida_N	2e-38	142.2	Aida N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000016476

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000009823	0.510	Axin 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019904	0.531	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0019222	0.851	regulation of metabolic process
GO:0060255	0.840	regulation of macromolecule metabolic process
GO:0080090	0.837	regulation of primary metabolic process
GO:0051171	0.836	regulation of nitrogen compound metabolic process
GO:0048523	0.835	negative regulation of cellular process
GO:0051246	0.834	regulation of protein metabolic process
GO:0048583	0.832	regulation of response to stimulus
GO:0009966	0.787	regulation of signal transduction
GO:0050790	0.719	regulation of catalytic activity
GO:0031323	0.715	regulation of cellular metabolic process
GO:0080134	0.669	regulation of response to stress
GO:0044092	0.633	negative regulation of molecular function
GO:0009968	0.633	negative regulation of signal transduction
GO:0045859	0.633	regulation of protein kinase activity
GO:0051172	0.632	negative regulation of nitrogen compound metabolic process
GO:0010605	0.628	negative regulation of macromolecule metabolic process
GO:0046329	0.597	negative regulation of JNK cascade
GO:0043506	0.595	regulation of JUN kinase activity
GO:0043407	0.595	negative regulation of MAP kinase activity
GO:0009987	0.420	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0016020	0.982	membrane
GO:0071944	0.767	cell periphery
GO:0005886	0.763	plasma membrane
GO:0043226	0.757	organelle
GO:0043227	0.597	membrane-bounded organelle
GO:0005829	0.568	cytosol
GO:0043229	0.553	intracellular organelle
GO:0032991	0.515	protein-containing complex
GO:0043231	0.507	intracellular membrane-bounded organelle
GO:0005634	0.475	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]