StarFunc result for job id Q96BK5

User Input

>input (328 residues)
MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEQGATDHIKVQV
KNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKIS
KNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQE
YFAKRMAALKNKPQVPVPGSDISETQVERKRGKKRNKEATGKDVESYLQPKAKRHTEGKP
ERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKK
KLQKPVEIAEDATLEETLVKKKKKKDSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96BK5	1.000	1.000	6.703E-50	328	1.000	1.000	Q96BK5.pdb.gz	PINX1_HUMAN PIN2/TERF1-interacting telomerase inhibitor 1 OS=Homo sapiens OX=9606 GN=PINX1 PE=1 SV=2
2	AFDB:Q5QGN4	0.384	0.360	2.297E-26	355	0.515	0.476	Q5QGN4.pdb.gz	Q5QGN4_DANRE Hepatocellular carcinoma-related putative tumor suppressor LPTS OS=Danio rerio OX=7955 GN=cb342 PE=2 SV=2
3	AFDB:Q3TFK5	0.172	0.140	2.330E-4	415	0.210	0.166	Q3TFK5.pdb.gz	GPTC4_MOUSE G patch domain-containing protein 4 OS=Mus musculus OX=10090 GN=Gpatch4 PE=1 SV=1
4	AFDB:Q5T3I0	0.150	0.114	2.490E-4	446	0.146	0.108	Q5T3I0.pdb.gz	GPTC4_HUMAN G patch domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GPATCH4 PE=1 SV=2
5	AFDB:Q9SF36	0.094	0.049	3.873E-2	726	0.131	0.059	Q9SF36.pdb.gz	PDP2_ARATH PWWP domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=PDP2 PE=1 SV=1
6	AFDB:Q5TZ89	0.084	0.056	6.166E-2	693	0.159	0.075	Q5TZ89.pdb.gz
7	AFDB:Q9VY99	0.098	0.033	1.670E-1	1201	0.101	0.027	Q9VY99.pdb.gz	NNAD_DROME Cytosolic carboxypeptidase Nna1 OS=Drosophila melanogaster OX=7227 GN=Nna1 PE=2 SV=2
8	AFDB:P06536	0.086	0.043	1.907E-1	795	0.110	0.045	P06536.pdb.gz	GCR_RAT Glucocorticoid receptor OS=Rattus norvegicus OX=10116 GN=Nr3c1 PE=1 SV=2
9	AFDB:P15891	0.073	0.049	2.487E-1	592	0.152	0.084	P15891.pdb.gz	ABP1_YEAST Actin-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ABP1 PE=1 SV=4
10	AFDB:Q8CD60	0.101	0.110	2.840E-1	292	0.128	0.144	Q8CD60.pdb.gz	INSY1_MOUSE Inhibitory synaptic factor 1 OS=Mus musculus OX=10090 GN=Insyn1 PE=1 SV=1
11	PDB:5o9zG	0.077	0.044	2.243	804	0.067	0.027	5o9zG.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
12	PDB:7r72w	0.067	0.095	2.243	189	0.070	0.122	7r72w.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
13	PDB:6lss4	0.091	0.060	3.126	620	0.143	0.076	6lss4.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
14	PDB:6c0f7	0.058	0.111	4.976	156	0.034	0.071	6c0f7.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
15	PDB:2kr0A	0.071	0.061	5.317	407	0.085	0.069	2kr0A.pdb.gz
16	PDB:7nacw	0.072	0.041	9.666	672	0.082	0.040	7nacw.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96BK5	0.0	674	328	1.000	1.000	PINX1_HUMAN PIN2/TERF1-interacting telomerase inhibitor 1 OS=Homo sapiens OX=9606 GN=PINX1 PE=1 SV=2
2	Q5QGN4	2.52e-91	278	355	0.412	0.380	Q5QGN4_DANRE Hepatocellular carcinoma-related putative tumor suppressor LPTS OS=Danio rerio OX=7955 GN=cb342 PE=2 SV=2
3	P53335	3.33e-17	82.4	271	0.131	0.159	PXR1_YEAST Protein PXR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PXR1 PE=1 SV=1
4	Q9URX9	6.89e-14	73.2	284	0.101	0.116	PXR1_SCHPO Protein pxr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pxr1 PE=1 SV=1
5	Q582H9	2.75e-08	56.2	271	0.070	0.085	Q582H9_TRYB2 G-patch domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.360 PE=4 SV=1
6	Q147M4	1.44e-07	54.3	301	0.082	0.090	Q147M4_ARATH At5g26610 OS=Arabidopsis thaliana OX=3702 GN=At5g26610 PE=1 SV=1
7	Q9VPY4	2.45e-06	51.6	1004	0.079	0.026	Q9VPY4_DROME FI21118p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4887 PE=1 SV=1
8	Q8SZM4	2.47e-06	51.6	1004	0.079	0.026	Q8SZM4_DROME RH03791p OS=Drosophila melanogaster OX=7227 GN=CG4887 PE=2 SV=1
9	O94585	3.07e-06	49.3	187	0.064	0.112	YQ7D_SCHPO Meiotically up-regulated protein C1442.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1442.13c PE=1 SV=3
10	Q3TFK5	1.07e-05	49.3	415	0.119	0.094	GPTC4_MOUSE G patch domain-containing protein 4 OS=Mus musculus OX=10090 GN=Gpatch4 PE=1 SV=1
11	P52756	3.67e-05	47.8	815	0.067	0.027	RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens OX=9606 GN=RBM5 PE=1 SV=2
12	Q94C11	1.02e-04	46.2	443	0.061	0.045	SUGP1_ARATH SURP and G-patch domain-containing protein 1-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g52120 PE=1 SV=1
13	A2A6A1	1.60e-04	45.8	1505	0.058	0.013	GPTC8_MOUSE G patch domain-containing protein 8 OS=Mus musculus OX=10090 GN=Gpatch8 PE=1 SV=1
14	Q9UTK6	1.81e-04	45.4	797	0.055	0.023	YKR3_SCHPO G-patch domain-containing protein C1486.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1486.03c PE=3 SV=1
15	Q9UKJ3	1.96e-04	45.8	1502	0.058	0.013	GPTC8_HUMAN G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8 PE=1 SV=2
16	Q940M0	2.82e-04	44.7	391	0.104	0.087	GPDP1_ARATH G-patch domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=GDP1 PE=2 SV=1
17	Q08CK9	5.41e-04	44.3	774	0.058	0.025	Q08CK9_DANRE Angiogenic factor with G patch and FHA domains 1 OS=Danio rerio OX=7955 GN=zgc:152959 PE=2 SV=1
18	O74363	6.85e-04	43.9	695	0.061	0.029	YND2_SCHPO G-patch and R3H domain-containing protein C30B4.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC30B4.02c PE=4 SV=1
19	Q99KG3	8.26e-04	43.5	930	0.058	0.020	RBM10_MOUSE RNA-binding protein 10 OS=Mus musculus OX=10090 GN=Rbm10 PE=1 SV=1
20	A0A0S2Z4W4	8.63e-04	43.5	930	0.058	0.020	A0A0S2Z4W4_HUMAN RNA binding motif protein 10 isoform 2 (Fragment) OS=Homo sapiens OX=9606 GN=RBM10 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01585 G-patch	3.4e-12	57.3	G-patch domain
2	PF12656 G-patch_2	0.00012	33.5	G-patch domain
3	PF14046 NR_Repeat	3.9e+02	12.5	Nuclear receptor repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318966

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309572	0.999	Telomerase reverse transcriptase
2	9606.ENSP00000276603	0.997	Telomeric repeat-binding factor 1
3	9606.ENSP00000336741	0.997	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15
4	9606.ENSP00000358563	0.968	H/ACA ribonucleoprotein complex subunit 4
5	9606.ENSP00000230340	0.961	Bystin
6	9606.ENSP00000363746	0.958	WD repeat-containing protein 46
7	9606.ENSP00000371858	0.944	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
8	9606.ENSP00000335153	0.940	Heat shock protein HSP 90-alpha
9	9606.ENSP00000483495	0.924	Probable ATP-dependent RNA helicase DDX27
10	9606.ENSP00000223073	0.920	RNA-binding protein 28
11	9606.ENSP00000479504	0.919	Probable ATP-dependent RNA helicase DDX52
12	9606.ENSP00000348596	0.916	Protein SDA1 homolog
13	9606.ENSP00000482075	0.912	Prostaglandin E synthase 3
14	9606.ENSP00000274849	0.909	Activator of basal transcription 1
15	9606.ENSP00000323858	0.908	ATP-dependent RNA helicase DDX54
16	9606.ENSP00000356548	0.908	Protein LTV1 homolog
17	9606.ENSP00000225296	0.907	Putative ATP-dependent RNA helicase DHX33
18	9606.ENSP00000221801	0.896	rRNA 2'-O-methyltransferase fibrillarin
19	9606.ENSP00000481495	0.892	ATP-dependent RNA helicase DDX24
20	9606.ENSP00000247003	0.891	Probable ATP-dependent RNA helicase DDX49

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0004857	1.000	enzyme inhibitor activity
GO:0070034	1.000	telomerase RNA binding
GO:0010521	0.990	telomerase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0044260	0.978	cellular macromolecule metabolic process
GO:0006996	0.976	organelle organization
GO:0051179	0.970	localization
GO:0051052	0.968	regulation of DNA metabolic process
GO:0033044	0.966	regulation of chromosome organization
GO:0000723	0.966	telomere maintenance
GO:2000278	0.963	regulation of DNA biosynthetic process
GO:0048518	0.958	positive regulation of biological process
GO:2001251	0.958	negative regulation of chromosome organization
GO:0032204	0.958	regulation of telomere maintenance
GO:0010833	0.956	telomere maintenance via telomere lengthening
GO:0006278	0.955	RNA-templated DNA biosynthetic process
GO:0048522	0.954	positive regulation of cellular process
GO:0007004	0.953	telomere maintenance via telomerase
GO:0051641	0.952	cellular localization
GO:0051338	0.952	regulation of transferase activity
GO:0010564	0.947	regulation of cell cycle process
GO:1903047	0.941	mitotic cell cycle process
GO:0051656	0.939	establishment of organelle localization
GO:0033365	0.934	protein localization to organelle
GO:0051053	0.923	negative regulation of DNA metabolic process
GO:0051303	0.920	establishment of chromosome localization
GO:0045786	0.910	negative regulation of cell cycle
GO:1904356	0.910	regulation of telomere maintenance via telomere lengthening
GO:0034502	0.909	protein localization to chromosome
GO:0032210	0.903	regulation of telomere maintenance via telomerase
GO:0051972	0.891	regulation of telomerase activity
GO:0031327	0.877	negative regulation of cellular biosynthetic process
GO:0010558	0.876	negative regulation of macromolecule biosynthetic process
GO:2000279	0.874	negative regulation of DNA biosynthetic process
GO:0007059	0.861	chromosome segregation
GO:0007080	0.842	mitotic metaphase plate congression
GO:0010948	0.836	negative regulation of cell cycle process
GO:0007346	0.772	regulation of mitotic cell cycle
GO:0044093	0.695	positive regulation of molecular function
GO:1902749	0.602	regulation of cell cycle G2/M phase transition
GO:0051246	0.595	regulation of protein metabolic process
GO:0044092	0.514	negative regulation of molecular function
GO:0060341	0.500	regulation of cellular localization
GO:0031399	0.485	regulation of protein modification process
GO:0051098	0.402	regulation of binding
GO:0045930	0.398	negative regulation of mitotic cell cycle
GO:0065008	0.393	regulation of biological quality
GO:0032205	0.376	negative regulation of telomere maintenance
GO:1903829	0.338	positive regulation of protein localization
GO:0044085	0.324	cellular component biogenesis
GO:1902750	0.324	negative regulation of cell cycle G2/M phase transition
GO:0043086	0.318	negative regulation of catalytic activity
GO:0051248	0.318	negative regulation of protein metabolic process
GO:1903320	0.313	regulation of protein modification by small protein conjugation or removal

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:0005737	0.989	cytoplasm
GO:0005694	0.978	chromosome
GO:0098687	0.851	chromosomal region
GO:0005739	0.805	mitochondrion
GO:0000793	0.721	condensed chromosome
GO:0000775	0.694	chromosome, centromeric region
GO:0005856	0.691	cytoskeleton
GO:0099080	0.678	supramolecular complex
GO:0015630	0.638	microtubule cytoskeleton
GO:0000781	0.595	chromosome, telomeric region
GO:0000779	0.538	condensed chromosome, centromeric region
GO:0005829	0.470	cytosol
GO:0005819	0.414	spindle
GO:0000776	0.414	kinetochore
GO:0000228	0.396	nuclear chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]