StarFunc result for job id Q96BM0

User Input

>input (104 residues)
MGKESGWDSGRAAVAAVVGGVVAVGTVLVALSAMGFTSVGIAASSIAAKMMSTAAIANGG
GVAAGSLVAILQSVGAAGLSVTSKVIGGFAGTALGAWLGSPPSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Click to view	Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
	1	AFDB:Q96BM0	1.000	1.000	3.183E-13	104	1.000	1.000	Q96BM0.pdb.gz	I27L1_HUMAN Interferon alpha-inducible protein 27-like protein 1 OS=Homo sapiens OX=9606 GN=IFI27L1 PE=1 SV=1
	2	AFDB:A0A0H3LG06	0.258	0.280	3.857	95	0.231	0.253	A0A0H3LG06.pdb.gz	A0A0H3LG06_MYCTE ESAT-6-like protein OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) OX=652616 GN=esxA PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96BM0	2.00e-61	184	104	1.000	1.000	I27L1_HUMAN Interferon alpha-inducible protein 27-like protein 1 OS=Homo sapiens OX=9606 GN=IFI27L1 PE=1 SV=1
2	Q8C6G0	1.15e-23	92.8	260	0.587	0.235	Q8C6G0_MOUSE Interferon, alpha-inducible protein 27 OS=Mus musculus OX=10090 GN=Ifi27 PE=1 SV=2
3	Q70LN3	1.30e-23	92.8	260	0.587	0.235	Q70LN3_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=2 SV=1
4	P40305	5.61e-23	87.8	122	0.529	0.451	IFI27_HUMAN Interferon alpha-inducible protein 27, mitochondrial OS=Homo sapiens OX=9606 GN=IFI27 PE=1 SV=4
5	Q9D1E1	8.13e-23	89.7	215	0.567	0.274	Q9D1E1_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=1 SV=1
6	Q3UK07	8.86e-23	89.7	215	0.567	0.274	Q3UK07_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=2 SV=1
7	Q70LM9	3.46e-20	81.6	165	0.500	0.315	Q70LM9_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=1 SV=1
8	Q9H2X8	4.27e-20	80.5	130	0.538	0.431	I27L2_HUMAN Interferon alpha-inducible protein 27-like protein 2 OS=Homo sapiens OX=9606 GN=IFI27L2 PE=2 SV=1
9	Q70LN0	4.52e-20	82.4	205	0.510	0.259	Q70LN0_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=1 SV=1
10	Q6P9X5	8.74e-20	81.3	182	0.500	0.286	Q6P9X5_RAT Interferon, alpha-inducible protein 27-like OS=Rattus norvegicus OX=10116 GN=Ifi27 PE=2 SV=1
11	A0A8I5ZTN9	1.26e-19	81.3	209	0.490	0.244	A0A8I5ZTN9_RAT Interferon, alpha-inducible protein 27 OS=Rattus norvegicus OX=10116 GN=Ifi27 PE=3 SV=1
12	Q70LN2	1.40e-19	82.0	250	0.500	0.208	Q70LN2_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=2 SV=1
13	E9Q1C5	1.46e-19	82.0	250	0.500	0.208	E9Q1C5_MOUSE Interferon, alpha-inducible protein 27 OS=Mus musculus OX=10090 GN=Ifi27 PE=1 SV=1
14	G3V761	2.64e-19	79.7	182	0.490	0.280	G3V761_RAT Interferon, alpha-inducible protein 27 OS=Rattus norvegicus OX=10116 GN=Ifi27 PE=3 SV=1
15	Q8R412	2.81e-19	77.4	90	0.452	0.522	IF27A_MOUSE Interferon alpha-inducible protein 27-like protein 2A OS=Mus musculus OX=10090 GN=Ifi27l2a PE=2 SV=1
16	D3ZIG6	3.58e-18	77.0	179	0.442	0.257	D3ZIG6_RAT Interferon, alpha-inducible protein 27 OS=Rattus norvegicus OX=10116 GN=Ifi27 PE=3 SV=3
17	P09912	2.69e-13	63.2	130	0.442	0.354	IFI6_HUMAN Interferon alpha-inducible protein 6 OS=Homo sapiens OX=9606 GN=IFI6 PE=1 SV=2
18	Q8VC49	4.82e-07	48.1	283	0.529	0.194	IF27B_MOUSE Interferon alpha-inducible protein 27-like protein 2B OS=Mus musculus OX=10090 GN=Ifi27l2b PE=1 SV=1
19	D3Z4L8	2.5	28.5	105	0.221	0.219	D3Z4L8_MOUSE Interferon, alpha-inducible protein 27 (Fragment) OS=Mus musculus OX=10090 GN=Ifi27 PE=1 SV=1
20	O35568	4.9	28.5	493	0.135	0.028	FBLN3_RAT EGF-containing fibulin-like extracellular matrix protein 1 OS=Rattus norvegicus OX=10116 GN=Efemp1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06140 Ifi-6-16	6.1e-22	88.7	Interferon-induced 6-16 family
2	PF06699 PIG-F	6.2e+02	11.9	GPI biosynthesis protein family Pig-F

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000451851

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360874	0.630	Interferon induced protein with tetratricopeptide repeats 1B
2	9606.ENSP00000360860	0.539	Interferon-induced protein with tetratricopeptide repeats 5
3	9606.ENSP00000359787	0.537	Interferon-induced protein 44-like
4	9606.ENSP00000372059	0.530	Interferon-induced transmembrane protein 5
5	9606.ENSP00000359783	0.505	Interferon-induced protein 44

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.978	cellular process
GO:0050896	0.809	response to stimulus
GO:0008219	0.665	cell death
GO:0051707	0.655	response to other organism
GO:0050789	0.648	regulation of biological process
GO:0050794	0.580	regulation of cellular process
GO:0012501	0.529	programmed cell death
GO:0006915	0.506	apoptotic process
GO:0009615	0.477	response to virus
GO:0006952	0.402	defense response
GO:0098542	0.381	defense response to other organism
GO:0140546	0.355	defense response to symbiont
GO:0051607	0.336	defense response to virus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031966	0.999	mitochondrial membrane
GO:0005634	0.987	nucleus
GO:0012505	0.691	endomembrane system
GO:0005829	0.502	cytosol
GO:0005576	0.397	extracellular region
GO:0019866	0.303	organelle inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]