StarFunc result for job id Q96BM1

User Input

>input (317 residues)
MPWDARRPGGGADGGPEASGAARSRAQKQCRKSSFAFYQAVRDLLPVWLLEDMRASEAFH
WDERGRAAAYSPSEALLYALVHDHQAYAHYLLATFPRRALAPPSAGFRCCAAPGPHVALA
VRYNRVGILRRILRTLRDFPAEERARVLDRRGCSRVEGGGTSLHVACELARPECLFLLLG
HGASPGLRDGGGLTPLELLLRQLGRDAGATPSAAGAPASAPGEPRQRRLLLLDLLALYTP
VGAAGSARQELLGDRPRWQRLLGEDKFQWLAGLAPPSLFARAMQVLVTAISPGRFPEALD
ELPLPPFLQPLDLTGKG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96BM1	1.000	1.000	2.604E-47	317	1.000	1.000	Q96BM1.pdb.gz	ANKR9_HUMAN Ankyrin repeat domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ANKRD9 PE=1 SV=1
2	AFDB:Q65XV2	0.384	0.284	2.193E-4	450	0.164	0.116	Q65XV2.pdb.gz	XB3_ORYSJ E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica OX=39947 GN=XB3 PE=1 SV=1
3	AFDB:Q8WXI3	0.223	0.170	2.399E-4	467	0.227	0.154	Q8WXI3.pdb.gz	ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens OX=9606 GN=ASB10 PE=1 SV=2
4	AFDB:Q9H765	0.472	0.512	3.440E-4	288	0.180	0.198	Q9H765.pdb.gz	ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens OX=9606 GN=ASB8 PE=1 SV=1
5	AFDB:D3ZUV2	0.420	0.156	5.904E-4	1006	0.151	0.048	D3ZUV2.pdb.gz	D3ZUV2_RAT RING-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Mib1 PE=4 SV=3
6	AFDB:Q04749	0.437	0.335	8.855E-4	426	0.148	0.110	Q04749.pdb.gz	AVO2_YEAST Target of rapamycin complex 2 subunit AVO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVO2 PE=1 SV=1
7	AFDB:B6D5I6	0.335	0.125	9.263E-4	1115	0.132	0.038	B6D5I6.pdb.gz
8	AFDB:Q8GZ22	0.353	0.441	1.060E-3	240	0.164	0.217	Q8GZ22.pdb.gz	Q8GZ22_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At2g03430 PE=1 SV=1
9	AFDB:P0C6S7	0.358	0.111	1.109E-3	1260	0.167	0.042	P0C6S7.pdb.gz	ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus OX=10116 GN=Anks1b PE=1 SV=1
10	AFDB:Q2TB02	0.410	0.399	1.109E-3	327	0.170	0.165	Q2TB02.pdb.gz	IKBD_MOUSE NF-kappa-B inhibitor delta OS=Mus musculus OX=10090 GN=Nfkbid PE=1 SV=2
11	PDB:6jd6B	0.377	0.592	1.266E-3	192	0.123	0.203	6jd6B.pdb.gz
12	PDB:2dvwA	0.367	0.480	3.260E-3	229	0.142	0.197	2dvwA.pdb.gz
13	PDB:8cs9A	0.357	0.162	4.468E-3	796	0.167	0.067	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
14	PDB:1bd8A	0.368	0.685	8.023E-3	156	0.101	0.205	1bd8A.pdb.gz
15	PDB:6dmwA	0.382	0.209	8.393E-3	631	0.164	0.082	6dmwA.pdb.gz	Structural insights on TRPV5 gating by endogenous modulators.
16	PDB:6v9hC	0.257	0.282	1.150E-2	270	0.120	0.141	6v9hC.pdb.gz
17	PDB:4oauC	0.319	0.176	1.805E-2	692	0.142	0.065	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
18	PDB:4bszB	0.310	0.606	3.240E-2	150	0.079	0.167	4bszB.pdb.gz
19	PDB:1wg0A	0.278	0.336	1.196E-1	243	0.091	0.119	1wg0A.pdb.gz
20	PDB:7df7B	0.286	0.687	1.251E-1	119	0.082	0.218	7df7B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96BM1	0.0	619	317	1.000	1.000	ANKR9_HUMAN Ankyrin repeat domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ANKRD9 PE=1 SV=1
2	P97570	8.16e-06	49.7	807	0.095	0.037	PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus OX=10116 GN=Pla2g6 PE=1 SV=2
3	P97819	8.16e-06	49.7	807	0.095	0.037	PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus OX=10090 GN=Pla2g6 PE=1 SV=3
4	O60733	3.84e-05	47.8	806	0.095	0.037	PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G6 PE=1 SV=2
5	A0A590UJC7	4.03e-05	47.4	760	0.095	0.039	A0A590UJC7_HUMAN phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G6 PE=1 SV=1
6	A0A590UK51	4.03e-05	47.8	820	0.095	0.037	A0A590UK51_HUMAN phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G6 PE=1 SV=1
7	A0A072VIM5	4.85e-05	47.0	492	0.101	0.065	NOOT2_MEDTR BTB/POZ domain and ankyrin repeat-containing protein NOOT2 OS=Medicago truncatula OX=3880 GN=NOOT2 PE=2 SV=1
8	Q9ZVC2	6.27e-05	46.6	491	0.095	0.061	NPR5_ARATH Regulatory protein NPR5 OS=Arabidopsis thaliana OX=3702 GN=NPR5 PE=1 SV=1
9	A0A3L7I2I8	1.03e-04	46.2	807	0.091	0.036	PLPL9_CRIGR 85/88 kDa calcium-independent phospholipase A2 OS=Cricetulus griseus OX=10029 GN=PLA2G6 PE=1 SV=1
10	A2CIR7	2.16e-04	45.1	506	0.098	0.061	NPR5_ORYSJ BTB/POZ domain and ankyrin repeat-containing protein NPR5 OS=Oryza sativa subsp. japonica OX=39947 GN=NPR5 PE=1 SV=1
11	G8GTN7	3.02e-04	44.7	483	0.091	0.060	COCH_PEA BTB/POZ domain and ankyrin repeat-containing protein COCH OS=Pisum sativum OX=3888 GN=COCH PE=2 SV=1
12	Q2HW56	3.19e-04	44.7	482	0.091	0.060	NOOT1_MEDTR BTB/POZ domain and ankyrin repeat-containing protein NOOT1 OS=Medicago truncatula OX=3880 GN=NOOT1 PE=2 SV=1
13	Q9M1I7	3.62e-04	44.3	467	0.088	0.060	NPR6_ARATH Regulatory protein NPR6 OS=Arabidopsis thaliana OX=3702 GN=NPR6 PE=1 SV=1
14	Q2QXZ2	7.34e-04	43.5	494	0.126	0.081	NH52_ORYSJ BTB/POZ domain and ankyrin repeat-containing protein NH5.2 OS=Oryza sativa subsp. japonica OX=39947 GN=NH5.2 PE=1 SV=1
15	Q2RAQ5	7.34e-04	43.5	494	0.095	0.061	NH51_ORYSJ BTB/POZ domain and ankyrin repeat-containing protein NH5.1 OS=Oryza sativa subsp. japonica OX=39947 GN=NH5.1 PE=1 SV=1
16	Q05823	0.002	42.4	741	0.098	0.042	RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens OX=9606 GN=RNASEL PE=1 SV=2
17	Q1RLL8	0.002	42.4	741	0.098	0.042	Q1RLL8_HUMAN Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) OS=Homo sapiens OX=9606 GN=RNASEL PE=1 SV=1
18	Q0KIE7	0.003	42.0	1549	0.076	0.015	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
19	Q24241	0.003	42.0	1549	0.076	0.015	Q24241_DROME Ankyrin OS=Drosophila melanogaster OX=7227 GN=Ank PE=4 SV=1
20	Q385S7	0.003	41.2	392	0.066	0.054	Q385S7_TRYB2 Ankyrin repeat protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2520 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.5e+02	14.2	Ankyrin repeat
2	PF12796 Ank_2	28	16.7	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	7.2	18.4	Ankyrin repeat
4	PF13637 Ank_4	0.43	22.5	Ankyrin repeats (many copies)
5	PF13857 Ank_5	0.0008	30.9	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286918

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321584	0.914	Inosine-5'-monophosphate dehydrogenase 2
2	9606.ENSP00000376808	0.789	Cullin-5
3	9606.ENSP00000399938	0.775	FLYWCH-type zinc finger 1
4	9606.ENSP00000361748	0.771	Probable palmitoyltransferase ZDHHC12
5	9606.ENSP00000478121	0.768	Elongin-C
6	9606.ENSP00000262306	0.763	Elongin-B
7	9606.ENSP00000258787	0.741	Unconventional myosin-Ig
8	9606.ENSP00000309141	0.738	E3 ubiquitin-protein ligase MARCH3
9	9606.ENSP00000323816	0.732	Aryl hydrocarbon receptor repressor
10	9606.ENSP00000282369	0.708	E3 ubiquitin-protein ligase TRIM36
11	9606.ENSP00000289416	0.701	Acyl-coenzyme A synthetase ACSM3, mitochondrial
12	9606.ENSP00000354163	0.686	Protein FAM110A
13	9606.ENSP00000244573	0.684	Histone H1.1
14	9606.ENSP00000345096	0.681	Inosine-5'-monophosphate dehydrogenase 1
15	9606.ENSP00000305721	0.680	Inhibitor of Bruton tyrosine kinase
16	9606.ENSP00000273480	0.678	RING-box protein 2
17	9606.ENSP00000250495	0.650	NEDD8
18	9606.ENSP00000440396	0.642	Ankyrin repeat domain-containing protein 49
19	9606.ENSP00000220496	0.630	DnaJ homolog subfamily C member 17
20	9606.ENSP00000263401	0.600	COMM domain-containing protein 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990756	1.000	ubiquitin ligase-substrate adaptor activity
GO:0005515	0.997	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0044237	0.982	cellular metabolic process
GO:0043161	0.938	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0055080	0.931	monoatomic cation homeostasis
GO:0098771	0.930	inorganic ion homeostasis
GO:0032446	0.927	protein modification by small protein conjugation
GO:0055082	0.912	intracellular chemical homeostasis
GO:0055070	0.907	copper ion homeostasis
GO:0030003	0.889	intracellular monoatomic cation homeostasis
GO:0006878	0.877	intracellular copper ion homeostasis
GO:0016567	0.757	protein ubiquitination
GO:0065007	0.593	biological regulation
GO:0050789	0.474	regulation of biological process
GO:0050794	0.395	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0032991	0.992	protein-containing complex
GO:0031982	0.966	vesicle
GO:1902494	0.959	catalytic complex
GO:0140535	0.916	intracellular protein-containing complex
GO:1990234	0.908	transferase complex
GO:0031410	0.908	cytoplasmic vesicle
GO:0000151	0.888	ubiquitin ligase complex
GO:0031461	0.808	cullin-RING ubiquitin ligase complex
GO:0005634	0.755	nucleus
GO:0043233	0.530	organelle lumen
GO:0070013	0.523	intracellular organelle lumen
GO:0031466	0.438	Cul5-RING ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]