StarFunc result for job id Q96BN2

User Input

>input (335 residues)
MATFVSELEAAKKNLSEALGDNVKQYWANLKLWFKQKISKEEFDLEAHRLLTQDNVHSHN
DFLLAILTRCQILVSTPDGAGSLPWPGGSAAKPGKPKGKKKLSSVRQKFDHRFQPQNPLS
GAQQFVAKDPQDDDDLKLCSHTMMLPTRGQLEGRMIVTAYEHGLDNVTEEAVSAVVYAVE
NHLKDILTSVVSRRKAYRLRDGHFKYAFGSNVTPQPYLKNSVVAYNNLIESPPAFTAPCA
GQNPASHPPPDDAEQQAALLLACSGDTLPASLPPVNMYDLFEALQVHREVIPTHTVYALN
IERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5BJQ7	0.644	0.644	1.984E-47	335	0.967	0.967	Q5BJQ7.pdb.gz	TADA1_RAT Transcriptional adapter 1 OS=Rattus norvegicus OX=10116 GN=Tada1 PE=2 SV=2
2	PDB:7ktrJ	0.434	0.655	1.654E-24	214	0.636	0.995	7ktrJ.pdb.gz	Structure of the human SAGA coactivator complex.
3	AFDB:Q8IGU1	0.467	0.462	7.756E-14	339	0.254	0.251	Q8IGU1.pdb.gz	Q8IGU1_DROME Transcriptional adapter 1 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Ada1-1 PE=2 SV=1
4	AFDB:O82785	0.257	0.294	4.393E-5	291	0.134	0.155	O82785.pdb.gz	O82785_ARATH Transcriptional regulator of RNA polII, SAGA, subunit OS=Arabidopsis thaliana OX=3702 GN=At2g14850 PE=1 SV=1
5	AFDB:Q58G10	0.260	0.216	5.720E-5	407	0.179	0.147	Q58G10.pdb.gz	Q58G10_ARATH Transcriptional regulator of RNA polII, SAGA, subunit OS=Arabidopsis thaliana OX=3702 GN=At2g24530 PE=1 SV=1
6	AFDB:O81757	0.260	0.255	1.330E-4	342	0.164	0.161	O81757.pdb.gz	O81757_ARATH At4g33890 OS=Arabidopsis thaliana OX=3702 GN=At4g33890 PE=1 SV=1
7	AFDB:O61707	0.198	0.133	6.727E-2	523	0.161	0.103	O61707.pdb.gz	TAF4_CAEEL Transcription initiation factor TFIID subunit 4 OS=Caenorhabditis elegans OX=6239 GN=taf-4 PE=1 SV=2
8	AFDB:Q12030	0.160	0.251	1.408E-1	206	0.078	0.126	Q12030.pdb.gz	TAF10_YEAST Transcription initiation factor TFIID subunit 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF10 PE=1 SV=1
9	AFDB:P47867	0.105	0.089	2.264E-1	471	0.128	0.091	P47867.pdb.gz	SCG3_MOUSE Secretogranin-3 OS=Mus musculus OX=10090 GN=Scg3 PE=1 SV=1
10	PDB:6t9iH	0.175	0.254	4.814E-1	227	0.081	0.119	6t9iH.pdb.gz
11	AFDB:Q502W7	0.094	0.063	7.227E-1	563	0.155	0.092	Q502W7.pdb.gz	CCD38_HUMAN Coiled-coil domain-containing protein 38 OS=Homo sapiens OX=9606 GN=CCDC38 PE=2 SV=1
12	PDB:7egdD	0.206	0.335	7.740E-1	197	0.081	0.137	7egdD.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	AFDB:Q09856	0.079	0.057	8.467E-1	542	0.128	0.079	Q09856.pdb.gz	PRP3_SCHPO U4/U5/U6 small nuclear ribonucleoprotein prp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp3 PE=1 SV=1
14	PDB:7edxd	0.215	0.436	1.008	158	0.075	0.158	7edxd.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
15	PDB:7fbcA	0.108	0.085	1.537	461	0.048	0.035	7fbcA.pdb.gz
16	PDB:5ng5A	0.099	0.098	2.001	340	0.048	0.047	5ng5A.pdb.gz	An allosteric transport mechanism for the AcrAB-TolC Multidrug Efflux Pump.
17	PDB:6mzcK	0.122	0.194	3.051	202	0.099	0.163	6mzcK.pdb.gz
18	PDB:7nsuD	0.081	0.071	3.575	420	0.045	0.036	7nsuD.pdb.gz
19	PDB:5ew5A	0.082	0.063	4.906	490	0.045	0.031	5ew5A.pdb.gz
20	PDB:1b67A	0.104	0.458	5.452	68	0.033	0.162	1b67A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5BJQ7	0.0	676	335	0.967	0.967	TADA1_RAT Transcriptional adapter 1 OS=Rattus norvegicus OX=10116 GN=Tada1 PE=2 SV=2
2	Q96BN2	0.0	698	335	1.000	1.000	TADA1_HUMAN Transcriptional adapter 1 OS=Homo sapiens OX=9606 GN=TADA1 PE=1 SV=1
3	Q8IGU1	4.06e-31	122	339	0.284	0.280	Q8IGU1_DROME Transcriptional adapter 1 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Ada1-1 PE=2 SV=1
4	Q8IP99	2.17e-29	116	308	0.275	0.299	Q8IP99_DROME Transcriptional adapter 1 OS=Drosophila melanogaster OX=7227 GN=Ada1-1 PE=3 SV=1
5	Q8IPA1	2.17e-29	116	308	0.275	0.299	Q8IPA1_DROME Transcriptional adapter 1 OS=Drosophila melanogaster OX=7227 GN=Ada1-2 PE=2 SV=1
6	Q58G10	0.017	39.3	407	0.054	0.044	Q58G10_ARATH Transcriptional regulator of RNA polII, SAGA, subunit OS=Arabidopsis thaliana OX=3702 GN=At2g24530 PE=1 SV=1
7	O81757	0.050	37.7	342	0.069	0.067	O81757_ARATH At4g33890 OS=Arabidopsis thaliana OX=3702 GN=At4g33890 PE=1 SV=1
8	O82785	0.16	35.8	291	0.084	0.096	O82785_ARATH Transcriptional regulator of RNA polII, SAGA, subunit OS=Arabidopsis thaliana OX=3702 GN=At2g14850 PE=1 SV=1
9	Q501Z5	1.7	33.1	500	0.078	0.052	GTPB3_DANRE tRNA modification GTPase GTPBP3, mitochondrial OS=Danio rerio OX=7955 GN=gtpbp3 PE=2 SV=1
10	Q9FFI0	1.7	33.1	718	0.051	0.024	HDG9_ARATH Homeobox-leucine zipper protein HDG9 OS=Arabidopsis thaliana OX=3702 GN=HDG9 PE=2 SV=1
11	Q12060	3.2	32.0	488	0.069	0.047	HFI1_YEAST Transcriptional coactivator HFI1/ADA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HFI1 PE=1 SV=1
12	O23277	3.7	32.0	1330	0.069	0.017	PRD1_ARATH Protein PUTATIVE RECOMBINATION INITIATION DEFECT 1 OS=Arabidopsis thaliana OX=3702 GN=PRD1 PE=1 SV=3
13	D4A740	5.1	31.6	868	0.087	0.033	D4A740_RAT Interleukin 17 receptor A OS=Rattus norvegicus OX=10116 GN=Il17ra PE=4 SV=2
14	Q7ZX96	5.4	31.6	820	0.048	0.020	NUP93_XENLA Nuclear pore complex protein Nup93 OS=Xenopus laevis OX=8355 GN=nup93 PE=1 SV=1
15	Q12934	8.0	30.8	665	0.069	0.035	BFSP1_HUMAN Filensin OS=Homo sapiens OX=9606 GN=BFSP1 PE=1 SV=3
16	Q9BH11	9.5	30.4	534	0.051	0.032	ZP4_BOVIN Zona pellucida sperm-binding protein 4 OS=Bos taurus OX=9913 GN=ZP4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12767 SAGA-Tad1	6.2e-24	96.6	Transcriptional regulator of RNA polII, SAGA, subunit
2	PF05236 TAF4	1.4e+02	13.6	Transcription initiation factor TFIID component TAF4 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356848

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263974	0.997	Transcription initiation factor TFIID subunit 12
2	9606.ENSP00000336750	0.996	SPT7 like, STAGA complex gamma subunit
3	9606.ENSP00000316114	0.995	SAGA-associated factor 29
4	9606.ENSP00000299424	0.994	Transcription initiation factor TFIID subunit 10
5	9606.ENSP00000352925	0.994	Transformation/transcription domain-associated protein
6	9606.ENSP00000263754	0.993	Histone acetyltransferase KAT2B
7	9606.ENSP00000307684	0.992	Transcriptional adapter 3
8	9606.ENSP00000397259	0.992	Ataxin-7-like protein 3
9	9606.ENSP00000294168	0.991	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L
10	9606.ENSP00000370193	0.991	Transcription initiation factor TFIID subunit 9
11	9606.ENSP00000308022	0.990	Transcriptional adapter 2-beta
12	9606.ENSP00000258281	0.989	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
13	9606.ENSP00000339917	0.985	Transcription initiation factor TFIID subunit 9B
14	9606.ENSP00000360515	0.985	Transcription initiation protein SPT3 homolog
15	9606.ENSP00000417510	0.985	SPT20 homolog, SAGA complex component
16	9606.ENSP00000225916	0.979	Histone acetyltransferase KAT2A
17	9606.ENSP00000252996	0.971	Transcription initiation factor TFIID subunit 4
18	9606.ENSP00000358854	0.955	Transcription initiation factor TFIID subunit 5
19	9606.ENSP00000399982	0.954	Transcription initiation factor TFIID subunit 6
20	9606.ENSP00000481091	0.953	Transcriptional adapter 2-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity
GO:1901363	0.310	heterocyclic compound binding
GO:0097159	0.310	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0036211	0.987	protein modification process
GO:0016570	0.980	histone modification
GO:0016578	0.966	histone deubiquitination
GO:0009987	0.681	cellular process
GO:0050794	0.672	regulation of cellular process
GO:0019222	0.616	regulation of metabolic process
GO:0080090	0.607	regulation of primary metabolic process
GO:0060255	0.607	regulation of macromolecule metabolic process
GO:0051171	0.607	regulation of nitrogen compound metabolic process
GO:0010468	0.601	regulation of gene expression
GO:0019219	0.598	regulation of nucleobase-containing compound metabolic process
GO:2001141	0.588	regulation of RNA biosynthetic process
GO:0006357	0.577	regulation of transcription by RNA polymerase II
GO:0016573	0.535	histone acetylation
GO:0043966	0.531	histone H3 acetylation
GO:0035522	0.481	monoubiquitinated histone H2A deubiquitination
GO:0044237	0.379	cellular metabolic process
GO:0048518	0.369	positive regulation of biological process
GO:0048522	0.358	positive regulation of cellular process
GO:0010467	0.351	gene expression
GO:0006139	0.334	nucleobase-containing compound metabolic process
GO:0010604	0.333	positive regulation of macromolecule metabolic process
GO:0051173	0.315	positive regulation of nitrogen compound metabolic process
GO:0090304	0.314	nucleic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0000124	1.000	SAGA complex
GO:0005829	0.998	cytosol
GO:0030054	0.959	cell junction
GO:0070161	0.948	anchoring junction
GO:0030055	0.929	cell-substrate junction
GO:0140513	0.905	nuclear protein-containing complex
GO:0005925	0.902	focal adhesion
GO:0061695	0.455	transferase complex, transferring phosphorus-containing groups
GO:0055029	0.348	nuclear DNA-directed RNA polymerase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]