StarFunc result for job id Q96BN8

User Input

>input (352 residues)
MSRGTMPQPEAWPGASCAETPAREAAATARDGGKAAASGQPRPEMQCPAEHEEDMYRAAD
EIEKEKELLIHERGASEPRLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSI
RRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLLPEKLISKYNWIKQWKLGLKFDGK
NEDLVDKIKESLTLLRKKWAGLAEMRTAEARQIACDELFTNEAEEYSLYEAVKFLMLNRA
IELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRH
TIQVYRLSKYNTEEFITVYPTDPPKDWPVVTLIAEDDRHYNIPVRVCEETSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UCV8	0.853	0.853	2.930E-55	352	0.901	0.901	Q3UCV8.pdb.gz	OTUL_MOUSE Ubiquitin thioesterase otulin OS=Mus musculus OX=10090 GN=Otulin PE=1 SV=1
2	AFDB:Q9NUU6	0.726	0.718	3.159E-26	356	0.318	0.315	Q9NUU6.pdb.gz	OTULL_HUMAN Inactive ubiquitin thioesterase OTULINL OS=Homo sapiens OX=9606 GN=OTULINL PE=1 SV=1
3	PDB:4fjvA	0.474	0.689	1.995E-8	231	0.131	0.199	4fjvA.pdb.gz	The human otubain2-ubiquitin structure provides insights into the cleavage specificity of poly-ubiquitin-linkages.
4	PDB:4ddgA	0.509	0.456	3.721E-8	399	0.119	0.105	4ddgA.pdb.gz
5	PDB:4dhjA	0.465	0.627	6.256E-8	248	0.128	0.181	4dhjA.pdb.gz
6	AFDB:Q1ZXS6	0.471	0.261	1.225E-4	709	0.114	0.056	Q1ZXS6.pdb.gz	Q1ZXS6_CAEEL CRAL-TRIO domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ric-7 PE=1 SV=1
7	AFDB:Q8IVJ1	0.125	0.094	9.450E-2	513	0.099	0.068	Q8IVJ1.pdb.gz	S41A1_HUMAN Solute carrier family 41 member 1 OS=Homo sapiens OX=9606 GN=SLC41A1 PE=1 SV=2
8	AFDB:B0S5Y2	0.126	0.122	1.291E-1	377	0.085	0.080	B0S5Y2.pdb.gz
9	AFDB:A6NLX3	0.131	0.124	2.285E-1	237	0.119	0.177	A6NLX3.pdb.gz	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
10	AFDB:Q5BB29	0.113	0.088	2.671E-1	499	0.122	0.086	Q5BB29.pdb.gz	Q5BB29_EMENI UPF0187 domain membrane protein (AFU_orthologue AFUA_5G06660) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02251 PE=4 SV=1
11	AFDB:G3V6I6	0.122	0.117	2.963E-1	375	0.085	0.080	G3V6I6.pdb.gz	G3V6I6_RAT Adiponectin receptor 1 OS=Rattus norvegicus OX=10116 GN=Adipor1 PE=3 SV=1
12	AFDB:P39935	0.101	0.056	3.647E-1	952	0.142	0.053	P39935.pdb.gz	IF4F1_YEAST Eukaryotic initiation factor 4F subunit p150 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIF4631 PE=1 SV=2
13	AFDB:A8DWJ8	0.113	0.043	4.262E-1	1340	0.105	0.028	A8DWJ8.pdb.gz	A8DWJ8_DROME NADPH oxidase, isoform C OS=Drosophila melanogaster OX=7227 GN=Nox PE=4 SV=1
14	PDB:4dl8A	0.163	0.223	4.280E-1	224	0.085	0.134	4dl8A.pdb.gz	On the catalytic mechanism of dimeric dUTPases.
15	PDB:7y47B	0.136	0.073	4.509E-1	767	0.082	0.038	7y47B.pdb.gz	Structural and mechanistic insights into the precise product synthesis by a bifunctional miltiradiene synthase.
16	PDB:3vv9B	0.115	0.135	5.550E-1	268	0.074	0.097	3vv9B.pdb.gz	Structure of the trypanosome cyanide-insensitive alternative oxidase
17	PDB:7p5jA	0.090	0.082	6.832E-1	399	0.065	0.058	7p5jA.pdb.gz
18	PDB:6n63A	0.131	0.245	7.579E-1	141	0.065	0.163	6n63A.pdb.gz	Large protein organelles form a new iron sequestration system with high storage capacity.
19	PDB:4f0tA	0.107	0.169	8.857E-1	162	0.062	0.136	4f0tA.pdb.gz
20	PDB:7qwkH	0.083	0.105	1.274	259	0.074	0.100	7qwkH.pdb.gz	The structure of human GCN2 reveals a parallel, back-to-back kinase dimer with a plastic DFG activation loop motif.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UCV8	0.0	665	352	0.901	0.901	OTUL_MOUSE Ubiquitin thioesterase otulin OS=Mus musculus OX=10090 GN=Otulin PE=1 SV=1
2	Q96BN8	0.0	736	352	1.000	1.000	OTUL_HUMAN Ubiquitin thioesterase otulin OS=Homo sapiens OX=9606 GN=OTULIN PE=1 SV=3
3	Q9NUU6	5.66e-74	234	356	0.318	0.315	OTULL_HUMAN Inactive ubiquitin thioesterase OTULINL OS=Homo sapiens OX=9606 GN=OTULINL PE=1 SV=1
4	Q980N4	0.68	34.3	397	0.080	0.071	CDC61_SACS2 ORC1-type DNA replication protein 1 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=cdc6-1 PE=1 SV=1
5	Q584N3	0.74	34.3	789	0.077	0.034	Q584N3_TRYB2 Retrotransposon hot spot (RHS) protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=3B10.95 PE=4 SV=1
6	Q584M9	0.76	34.3	789	0.077	0.034	Q584M9_TRYB2 Retrotransposon hot spot (RHS) protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=3B10.155 PE=4 SV=1
7	Q96DC9	1.1	33.1	234	0.037	0.056	OTUB2_HUMAN Ubiquitin thioesterase OTUB2 OS=Homo sapiens OX=9606 GN=OTUB2 PE=1 SV=2
8	Q38G02	2.9	32.3	456	0.060	0.046	Q38G02_TRYB2 Monooxygenase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.0390 PE=4 SV=1
9	Q585W5	4.1	32.0	3222	0.119	0.013	Q585W5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.840 PE=4 SV=1
10	Q8MSA2	4.8	31.6	872	0.060	0.024	Q8MSA2_DROME LP02069p OS=Drosophila melanogaster OX=7227 GN=CG14730 PE=2 SV=1
11	Q7KSN8	4.9	32.0	1486	0.060	0.014	Q7KSN8_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG14729 PE=1 SV=2
12	Q9VGG9	4.9	32.0	1483	0.060	0.014	Q9VGG9_DROME RE35509p OS=Drosophila melanogaster OX=7227 GN=CG14729 PE=1 SV=4
13	Q8MQK8	5.0	31.6	1006	0.060	0.021	Q8MQK8_DROME GM03621p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG14730 PE=2 SV=1
14	P05305	5.2	30.8	212	0.057	0.094	EDN1_HUMAN Endothelin-1 OS=Homo sapiens OX=9606 GN=EDN1 PE=1 SV=1
15	P38622	8.6	30.8	512	0.074	0.051	RCK1_YEAST Serine/threonine-protein kinase RCK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RCK1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16218 Peptidase_C101	4.2e-125	428.0	Peptidase family C101
2	PF10275 Peptidase_C65	2.9	18.8	Peptidase C65 Otubain
3	PF15494 SRCR_2	2.1e+02	14.0	Scavenger receptor cysteine-rich domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284274

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315112	0.999	E3 ubiquitin-protein ligase RNF31
2	9606.ENSP00000441543	0.998	Polyubiquitin-C
3	9606.ENSP00000348632	0.985	RanBP-type and C3HC4-type zinc finger-containing protein 1
4	9606.ENSP00000381698	0.984	Sharpin
5	9606.ENSP00000304697	0.981	Polyubiquitin-B
6	9606.ENSP00000357836	0.930	Sorting nexin-27
7	9606.ENSP00000462729	0.896	OTU domain-containing protein 7B
8	9606.ENSP00000005340	0.891	Segment polarity protein dishevelled homolog DVL-2
9	9606.ENSP00000156084	0.747	OTU domain-containing protein 5
10	9606.ENSP00000264553	0.742	Granzyme M
11	9606.ENSP00000416799	0.741	Spermatogenesis-associated protein 2
12	9606.ENSP00000368022	0.730	Optineurin
13	9606.ENSP00000352676	0.706	Ubiquitin thioesterase ZRANB1
14	9606.ENSP00000444357	0.703	Ubiquitin thioesterase OTUB1
15	9606.ENSP00000364261	0.698	OTU domain-containing protein 3
16	9606.ENSP00000280700	0.692	Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase
17	9606.ENSP00000392025	0.690	Ubiquitin carboxyl-terminal hydrolase CYLD
18	9606.ENSP00000365678	0.665	OTU domain-containing protein 1
19	9606.ENSP00000369681	0.655	Ubiquitin carboxyl-terminal hydrolase 3
20	9606.ENSP00000344208	0.642	Tripartite motif-containing protein 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0005515	0.991	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0050794	0.995	regulation of cellular process
GO:0019538	0.985	protein metabolic process
GO:0002831	0.979	regulation of response to biotic stimulus
GO:0070647	0.978	protein modification by small protein conjugation or removal
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0009987	0.973	cellular process
GO:0006508	0.973	proteolysis
GO:0080090	0.957	regulation of primary metabolic process
GO:0051171	0.956	regulation of nitrogen compound metabolic process
GO:0050896	0.954	response to stimulus
GO:0048518	0.949	positive regulation of biological process
GO:0002682	0.946	regulation of immune system process
GO:0023051	0.941	regulation of signaling
GO:0031323	0.941	regulation of cellular metabolic process
GO:0050776	0.931	regulation of immune response
GO:0009966	0.925	regulation of signal transduction
GO:0016579	0.913	protein deubiquitination
GO:0031326	0.906	regulation of cellular biosynthetic process
GO:0019219	0.906	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.904	regulation of gene expression
GO:0010556	0.903	regulation of macromolecule biosynthetic process
GO:0051252	0.900	regulation of RNA metabolic process
GO:0006355	0.894	regulation of DNA-templated transcription
GO:0065009	0.888	regulation of molecular function
GO:0051716	0.886	cellular response to stimulus
GO:0048519	0.886	negative regulation of biological process
GO:0048584	0.880	positive regulation of response to stimulus
GO:0080134	0.872	regulation of response to stress
GO:0006950	0.858	response to stress
GO:0032101	0.835	regulation of response to external stimulus
GO:0051090	0.834	regulation of DNA-binding transcription factor activity
GO:0031347	0.833	regulation of defense response
GO:0050727	0.815	regulation of inflammatory response
GO:0048585	0.801	negative regulation of response to stimulus
GO:0032088	0.782	negative regulation of NF-kappaB transcription factor activity
GO:0032102	0.780	negative regulation of response to external stimulus
GO:0010803	0.777	regulation of tumor necrosis factor-mediated signaling pathway
GO:0031348	0.775	negative regulation of defense response
GO:0050728	0.754	negative regulation of inflammatory response
GO:0045088	0.749	regulation of innate immune response
GO:0023052	0.715	signaling
GO:0007165	0.707	signal transduction
GO:0044419	0.677	biological process involved in interspecies interaction between organisms
GO:0002376	0.589	immune system process
GO:0016567	0.572	protein ubiquitination
GO:0002684	0.568	positive regulation of immune system process
GO:0006952	0.557	defense response
GO:0002757	0.550	immune response-activating signaling pathway
GO:0031349	0.539	positive regulation of defense response
GO:0032103	0.535	positive regulation of response to external stimulus
GO:0045089	0.522	positive regulation of innate immune response
GO:0009607	0.505	response to biotic stimulus
GO:0009605	0.484	response to external stimulus
GO:0051707	0.463	response to other organism
GO:0048523	0.443	negative regulation of cellular process
GO:0002221	0.420	pattern recognition receptor signaling pathway
GO:0030522	0.412	intracellular receptor signaling pathway
GO:0098542	0.401	defense response to other organism
GO:0048522	0.381	positive regulation of cellular process
GO:0006955	0.362	immune response
GO:0002753	0.353	cytosolic pattern recognition receptor signaling pathway
GO:0045087	0.342	innate immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.995	cytosol
GO:0032991	0.989	protein-containing complex
GO:1902494	0.880	catalytic complex
GO:0043231	0.762	intracellular membrane-bounded organelle
GO:1990234	0.725	transferase complex
GO:0043233	0.700	organelle lumen
GO:0140535	0.696	intracellular protein-containing complex
GO:0070013	0.674	intracellular organelle lumen
GO:0000151	0.650	ubiquitin ligase complex
GO:0005634	0.637	nucleus
GO:0031981	0.531	nuclear lumen
GO:0005654	0.428	nucleoplasm
GO:0071797	0.388	LUBAC complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]