StarFunc result for job id Q96BQ1

User Input

>input (224 residues)
MRVSGVLRLLALIFAIVTTWMFIRSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKP
CPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFD
MYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWV
FIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96BQ1	1.000	1.000	7.178E-43	224	1.000	1.000	Q96BQ1.pdb.gz	FAM3D_HUMAN Protein FAM3D OS=Homo sapiens OX=9606 GN=FAM3D PE=1 SV=1
2	AFDB:P97805	0.786	0.790	5.829E-34	223	0.710	0.713	P97805.pdb.gz	FAM3D_MOUSE Protein FAM3D OS=Mus musculus OX=10090 GN=Fam3d PE=2 SV=2
3	AFDB:P98173	0.773	0.753	7.607E-29	230	0.545	0.530	P98173.pdb.gz	FAM3A_HUMAN Protein FAM3A OS=Homo sapiens OX=9606 GN=FAM3A PE=1 SV=2
4	AFDB:Q92520	0.762	0.752	6.476E-28	227	0.504	0.498	Q92520.pdb.gz	FAM3C_HUMAN Protein FAM3C OS=Homo sapiens OX=9606 GN=FAM3C PE=1 SV=1
5	AFDB:P58499	0.728	0.695	7.314E-20	235	0.335	0.319	P58499.pdb.gz	FAM3B_HUMAN Protein FAM3B OS=Homo sapiens OX=9606 GN=FAM3B PE=1 SV=2
6	AFDB:Q9D309	0.724	0.692	1.360E-19	235	0.330	0.315	Q9D309.pdb.gz	FAM3B_MOUSE Protein FAM3B OS=Mus musculus OX=10090 GN=Fam3b PE=1 SV=1
7	PDB:2yopC	0.722	0.886	7.508E-18	181	0.281	0.348	2yopC.pdb.gz
8	AFDB:Q8WZA1	0.602	0.214	6.594E-12	660	0.188	0.064	Q8WZA1.pdb.gz	PMGT1_HUMAN Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=POMGNT1 PE=1 SV=2
9	AFDB:Q8BI06	0.441	0.076	1.141E-6	1361	0.138	0.023	Q8BI06.pdb.gz	CEMIP_MOUSE Cell migration-inducing and hyaluronan-binding protein OS=Mus musculus OX=10090 GN=Cemip PE=1 SV=4
10	AFDB:Q9UHN6	0.433	0.073	4.667E-6	1383	0.116	0.019	Q9UHN6.pdb.gz	CEIP2_HUMAN Inactive cell surface hyaluronidase CEMIP2 OS=Homo sapiens OX=9606 GN=CEMIP2 PE=1 SV=1
11	AFDB:A3KPQ7	0.472	0.090	9.179E-6	1378	0.116	0.019	A3KPQ7.pdb.gz	CEIP2_DANRE Cell surface hyaluronidase OS=Danio rerio OX=7955 GN=cemip2 PE=1 SV=1
12	PDB:2xn2A	0.149	0.055	6.508E-1	729	0.080	0.025	2xn2A.pdb.gz	Crystal Structure of Alpha-Galactosidase from Lactobacillus Acidophilus Ncfm: Insight Into Tetramer Formation and Substrate Binding.
13	PDB:1jcfA	0.164	0.117	6.885E-1	336	0.080	0.054	1jcfA.pdb.gz
14	PDB:4fnsA	0.093	0.044	1.081	718	0.080	0.025	4fnsA.pdb.gz	The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
15	PDB:7lkzA	0.151	0.028	1.280	1920	0.107	0.013	7lkzA.pdb.gz	Molecular structures of the eukaryotic retinal importer ABCA4.
16	PDB:1u0rD	0.183	0.148	1.516	301	0.067	0.050	1u0rD.pdb.gz
17	PDB:5z3gF	0.146	0.112	1.795	336	0.165	0.110	5z3gF.pdb.gz	Cryo-EM structure of an early precursor of large ribosomal subunit reveals a half-assembled intermediate.
18	PDB:7enar	0.119	0.122	1.899	206	0.098	0.107	7enar.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
19	PDB:3afoA	0.174	0.124	2.125	360	0.085	0.053	3afoA.pdb.gz	The structural factor conferring NADH kinase activity on yeast mitochondrial Pos5
20	PDB:4zgnA	0.117	0.097	2.125	279	0.036	0.029	4zgnA.pdb.gz	Cdc123, a Cell Cycle Regulator Needed for eIF2 Assembly, Is an ATP-Grasp Protein with Unique Features.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96BQ1	4.44e-168	463	224	1.000	1.000	FAM3D_HUMAN Protein FAM3D OS=Homo sapiens OX=9606 GN=FAM3D PE=1 SV=1
2	P97805	1.37e-120	343	223	0.714	0.717	FAM3D_MOUSE Protein FAM3D OS=Mus musculus OX=10090 GN=Fam3d PE=2 SV=2
3	P98173	4.60e-87	258	230	0.545	0.530	FAM3A_HUMAN Protein FAM3A OS=Homo sapiens OX=9606 GN=FAM3A PE=1 SV=2
4	Q92520	5.95e-79	238	227	0.491	0.485	FAM3C_HUMAN Protein FAM3C OS=Homo sapiens OX=9606 GN=FAM3C PE=1 SV=1
5	P58499	1.29e-39	138	235	0.335	0.319	FAM3B_HUMAN Protein FAM3B OS=Homo sapiens OX=9606 GN=FAM3B PE=1 SV=2
6	Q9D309	5.37e-38	134	235	0.330	0.315	FAM3B_MOUSE Protein FAM3B OS=Mus musculus OX=10090 GN=Fam3b PE=1 SV=1
7	C9JMN4	3.25e-37	129	151	0.281	0.417	C9JMN4_HUMAN FAM3 metabolism regulating signaling molecule C (Fragment) OS=Homo sapiens OX=9606 GN=FAM3C PE=1 SV=1
8	C9JP35	1.23e-33	118	109	0.259	0.532	C9JP35_HUMAN FAM3 metabolism regulating signaling molecule C (Fragment) OS=Homo sapiens OX=9606 GN=FAM3C PE=1 SV=1
9	Q8WZA1	3.12e-10	61.6	660	0.129	0.044	PMGT1_HUMAN Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=POMGNT1 PE=1 SV=2
10	Q91X88	3.49e-10	61.2	660	0.129	0.044	PMGT1_MOUSE Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Pomgnt1 PE=1 SV=1
11	Q8BI06	7.41e-09	57.8	1361	0.129	0.021	CEMIP_MOUSE Cell migration-inducing and hyaluronan-binding protein OS=Mus musculus OX=10090 GN=Cemip PE=1 SV=4
12	Q8WUJ3	2.73e-08	55.8	1361	0.125	0.021	CEMIP_HUMAN Cell migration-inducing and hyaluronan-binding protein OS=Homo sapiens OX=9606 GN=CEMIP PE=1 SV=2
13	A3KPQ7	2.38e-07	53.1	1378	0.129	0.021	CEIP2_DANRE Cell surface hyaluronidase OS=Danio rerio OX=7955 GN=cemip2 PE=1 SV=1
14	Q9UHN6	3.71e-04	43.5	1383	0.112	0.018	CEIP2_HUMAN Inactive cell surface hyaluronidase CEMIP2 OS=Homo sapiens OX=9606 GN=CEMIP2 PE=1 SV=1
15	Q08891	1.6	32.3	616	0.121	0.044	FACR2_ARATH Fatty acyl-CoA reductase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FAR2 PE=1 SV=2
16	Q93315	4.7	29.6	134	0.094	0.157	Q93315_CAEEL Cytochrome b5 heme-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cytb-5.1 PE=1 SV=2
17	G3V5X4	8.9	30.0	6818	0.129	0.004	G3V5X4_HUMAN Spectrin repeat containing nuclear envelope protein 2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15711 ILEI	7.6e-24	95.3	Interleukin-like EMT inducer

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351632

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000471493	0.619	fMet-Leu-Phe receptor
2	9606.ENSP00000331342	0.601	Rab11 family-interacting protein 1
3	9606.ENSP00000281543	0.559	Translation factor GUF1, mitochondrial
4	9606.ENSP00000361662	0.505	Guanylate cyclase activator 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.989	biological regulation
GO:0050789	0.982	regulation of biological process
GO:0023051	0.973	regulation of signaling
GO:0010646	0.973	regulation of cell communication
GO:0048519	0.940	negative regulation of biological process
GO:0048523	0.925	negative regulation of cellular process
GO:0046888	0.920	negative regulation of hormone secretion
GO:0050709	0.918	negative regulation of protein secretion
GO:0090276	0.859	regulation of peptide hormone secretion
GO:0050796	0.852	regulation of insulin secretion
GO:0046676	0.839	negative regulation of insulin secretion
GO:0009987	0.604	cellular process
GO:0050896	0.527	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.996	extracellular region
GO:0005615	0.990	extracellular space
GO:0012505	0.962	endomembrane system
GO:0043227	0.953	membrane-bounded organelle
GO:0005622	0.925	intracellular anatomical structure
GO:0043231	0.905	intracellular membrane-bounded organelle
GO:0005737	0.898	cytoplasm
GO:0016020	0.862	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]