StarFunc result for job id Q96BR9

User Input

>input (441 residues)
MEISSHQSHLLQQLNEQRRQDVFCDCSILVEGKVFKAHRNVLFASSGYFKMLLSQNSKET
SQPTTATFQAFSPDTFTVILDFVYSGKLSLTGQNVIEVMSAASFLQMTDVISVCKTFIKS
SLDISEKEKDRYFSLSDKDANSNGVERSSFYSGGWQEGSSSPRSHLSPEQGTGIISGKSW
NKYNYHPASQKNTQQPLAKHEPRKESIKKTKHLRLSQPSEVTHYKSSKREVRTSDSSSHV
SQSEEQAQIDAEMDSTPVGYQYGQGSDVTSKSFPDDLPRMRFKCPYCTHVVKRKADLKRH
LRCHTGERPYPCQACGKRFSRLDHLSSHFRTIHQACKLICRKCKRHVTDLTGQVVQEGTR
RYRLCNECLAEFGIDSLPIDLEAEQHLMSPSDGDKDSRWHLSEDENRSYVEIVEDGSGDL
VIQQVDDSEEEEEKEIKPNIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96BR9	1.000	1.000	4.588E-73	441	1.000	1.000	Q96BR9.pdb.gz	ZBT8A_HUMAN Zinc finger and BTB domain-containing protein 8A OS=Homo sapiens OX=9606 GN=ZBTB8A PE=1 SV=3
2	AFDB:Q8NAP8	0.316	0.284	5.127E-29	495	0.349	0.311	Q8NAP8.pdb.gz	ZBT8B_HUMAN Zinc finger and BTB domain-containing protein 8B OS=Homo sapiens OX=9606 GN=ZBTB8B PE=1 SV=2
3	AFDB:Q8BID6	0.281	0.211	4.576E-25	600	0.356	0.262	Q8BID6.pdb.gz	ZBT46_MOUSE Zinc finger and BTB domain-containing protein 46 OS=Mus musculus OX=10090 GN=Zbtb46 PE=1 SV=2
4	AFDB:Q8NCP5	0.286	0.226	8.670E-17	570	0.274	0.212	Q8NCP5.pdb.gz	ZBT44_HUMAN Zinc finger and BTB domain-containing protein 44 OS=Homo sapiens OX=9606 GN=ZBTB44 PE=1 SV=1
5	AFDB:O43298	0.279	0.264	1.610E-16	467	0.200	0.188	O43298.pdb.gz	ZBT43_HUMAN Zinc finger and BTB domain-containing protein 43 OS=Homo sapiens OX=9606 GN=ZBTB43 PE=1 SV=1
6	AFDB:Q9H5J0	0.271	0.213	2.950E-15	574	0.243	0.186	Q9H5J0.pdb.gz	ZBTB3_HUMAN Zinc finger and BTB domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBTB3 PE=1 SV=1
7	AFDB:Q15916	0.292	0.303	4.841E-15	424	0.179	0.186	Q15916.pdb.gz	ZBTB6_HUMAN Zinc finger and BTB domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ZBTB6 PE=1 SV=1
8	AFDB:Q96C00	0.245	0.229	7.941E-15	473	0.236	0.220	Q96C00.pdb.gz	ZBTB9_HUMAN Zinc finger and BTB domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZBTB9 PE=1 SV=1
9	AFDB:O15209	0.312	0.223	6.511E-14	634	0.240	0.167	O15209.pdb.gz	ZBT22_HUMAN Zinc finger and BTB domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZBTB22 PE=1 SV=1
10	AFDB:A0A024R8I0	0.233	0.176	9.317E-13	587	0.259	0.194	A0A024R8I0.pdb.gz
11	PDB:6wcqC	0.255	0.815	2.924E-8	130	0.063	0.215	6wcqC.pdb.gz
12	PDB:7mk2A	0.232	0.284	2.485E-5	354	0.061	0.076	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
13	PDB:6sgaFS	0.163	0.252	5.759E-3	277	0.036	0.058	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
14	PDB:6gypD	0.198	0.545	1.550E-2	151	0.039	0.113	6gypD.pdb.gz	Architecture of the CBF3-centromere complex of the budding yeast kinetochore.
15	PDB:2a79B	0.152	0.244	1.866E-2	259	0.052	0.089	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
16	PDB:6r7fQ	0.169	0.618	3.257E-2	112	0.032	0.125	6r7fQ.pdb.gz
17	PDB:2p1nD	0.186	0.603	3.922E-2	127	0.027	0.094	2p1nD.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
18	PDB:3w5kB	0.091	0.253	4.438E-2	110	0.068	0.273	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
19	PDB:7phhA	0.160	0.177	7.281E-2	396	0.039	0.043	7phhA.pdb.gz
20	PDB:7w6sB	0.154	0.152	7.746E-2	448	0.034	0.033	7w6sB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96BR9	0.0	917	441	0.998	0.998	ZBT8A_HUMAN Zinc finger and BTB domain-containing protein 8A OS=Homo sapiens OX=9606 GN=ZBTB8A PE=1 SV=3
2	Q8NAP8	2.81e-74	243	495	0.404	0.360	ZBT8B_HUMAN Zinc finger and BTB domain-containing protein 8B OS=Homo sapiens OX=9606 GN=ZBTB8B PE=1 SV=2
3	Q86UZ6	1.91e-39	151	589	0.163	0.122	ZBT46_HUMAN Zinc finger and BTB domain-containing protein 46 OS=Homo sapiens OX=9606 GN=ZBTB46 PE=1 SV=2
4	Q8BID6	2.02e-39	151	600	0.163	0.120	ZBT46_MOUSE Zinc finger and BTB domain-containing protein 46 OS=Mus musculus OX=10090 GN=Zbtb46 PE=1 SV=2
5	Q9WTY8	3.91e-32	131	836	0.143	0.075	ZBT10_RAT Zinc finger and BTB domain-containing protein 10 OS=Rattus norvegicus OX=10116 GN=Zbtb10 PE=2 SV=1
6	Q96DT7	8.18e-32	130	871	0.143	0.072	ZBT10_HUMAN Zinc finger and BTB domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZBTB10 PE=1 SV=2
7	Q60821	3.36e-27	117	794	0.243	0.135	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2
8	O43829	3.01e-21	97.8	449	0.234	0.229	ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZBTB14 PE=1 SV=2
9	D6RJ00	4.07e-21	91.3	146	0.113	0.342	D6RJ00_HUMAN Zinc finger and BTB domain containing 49 (Fragment) OS=Homo sapiens OX=9606 GN=ZBTB49 PE=1 SV=1
10	Q13105	5.08e-21	98.2	803	0.104	0.057	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
11	F1LMU5	8.62e-21	96.7	449	0.236	0.232	F1LMU5_RAT Zinc finger protein 161 OS=Rattus norvegicus OX=10116 GN=Zfp161 PE=1 SV=2
12	Q08376	8.62e-21	96.7	449	0.236	0.232	ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus OX=10090 GN=Zbtb14 PE=2 SV=1
13	Q70ZY9	1.69e-20	96.7	737	0.107	0.064	Q70ZY9_DANRE HIC1 protein OS=Danio rerio OX=7955 GN=zfHIC1 PE=2 SV=1
14	Q8CGQ6	2.35e-20	95.1	449	0.234	0.229	Q8CGQ6_RAT Zinc finger protein 161 OS=Rattus norvegicus OX=10116 GN=Zfp161 PE=2 SV=1
15	Q6ZSB9	3.20e-20	95.9	765	0.113	0.065	ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens OX=9606 GN=ZBTB49 PE=1 SV=3
16	Q9H5J0	5.73e-20	94.7	574	0.134	0.103	ZBTB3_HUMAN Zinc finger and BTB domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBTB3 PE=1 SV=1
17	P10074	6.97e-19	91.7	688	0.209	0.134	TZAP_HUMAN Telomere zinc finger-associated protein OS=Homo sapiens OX=9606 GN=ZBTB48 PE=1 SV=2
18	Q8N143	9.24e-19	90.5	479	0.240	0.221	BCL6B_HUMAN B-cell CLL/lymphoma 6 member B protein OS=Homo sapiens OX=9606 GN=BCL6B PE=2 SV=2
19	A8KA13	1.24e-18	90.1	480	0.240	0.221	A8KA13_HUMAN B-cell CLL/lymphoma 6, member B (Zinc finger protein), isoform CRA_a OS=Homo sapiens OX=9606 GN=BCL6B PE=1 SV=1
20	O88282	1.28e-18	90.1	474	0.249	0.232	BCL6B_MOUSE B-cell CLL/lymphoma 6 member B protein OS=Mus musculus OX=10090 GN=Bcl6b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	5.9e-24	95.8	BTB/POZ domain
2	PF02214 BTB_2	2.9	19.6	BTB/POZ domain
3	PF11822 SANBR_BTB	0.016	26.8	SANT and BTB domain regulator of CSR, BTB domain
4	PF00096 zf-C2H2	0.01	27.4	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	4.4	19.4	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	1.1e+02	14.3	C2H2-type zinc finger
7	PF13465 zf-H2C2_2	6.9e-05	34.3	Zinc-finger double domain
8	PF13909 zf-H2C2_5	0.24	22.5	C2H2-type zinc-finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362609

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000415836	0.646	Zinc finger protein 276
2	9606.ENSP00000485078	0.544	Olfactory receptor 52B4
3	9606.ENSP00000304846	0.543	Olfactory receptor 2AT4
4	9606.ENSP00000413017	0.520	Coiled-coil domain-containing protein 28B
5	9606.ENSP00000378642	0.519	Zinc finger protein 785

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001227	0.999	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000976	0.998	transcription cis-regulatory region binding
GO:0001223	0.992	transcription coactivator binding
GO:0140297	0.925	DNA-binding transcription factor binding
GO:0061629	0.916	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0006355	0.975	regulation of DNA-templated transcription
GO:0048523	0.916	negative regulation of cellular process
GO:0031327	0.871	negative regulation of cellular biosynthetic process
GO:0010558	0.840	negative regulation of macromolecule biosynthetic process
GO:1902679	0.823	negative regulation of RNA biosynthetic process
GO:0045892	0.786	negative regulation of DNA-templated transcription
GO:0006357	0.643	regulation of transcription by RNA polymerase II
GO:0000122	0.532	negative regulation of transcription by RNA polymerase II
GO:0009987	0.378	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.971	nuclear lumen
GO:0005654	0.959	nucleoplasm
GO:0043228	0.953	non-membrane-bounded organelle
GO:0043232	0.938	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]