StarFunc result for job id Q96BS2

User Input

>input (214 residues)
MGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRS
KIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFH
MYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYE
GITFEDFLKIWQGIDIETKMHVRFLNMETMALCH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96BS2	1.000	1.000	3.479E-36	214	1.000	1.000	Q96BS2.pdb.gz	CHP3_HUMAN Calcineurin B homologous protein 3 OS=Homo sapiens OX=9606 GN=TESC PE=1 SV=3
2	AFDB:A0AVX7	0.912	0.912	1.484E-27	214	0.706	0.706	A0AVX7.pdb.gz	CHP3_CHICK Calcineurin B homologous protein 3 OS=Gallus gallus OX=9031 GN=TESC PE=2 SV=1
3	AFDB:P61022	0.750	0.818	2.476E-12	195	0.327	0.359	P61022.pdb.gz	CHP1_MOUSE Calcineurin B homologous protein 1 OS=Mus musculus OX=10090 GN=Chp1 PE=1 SV=2
4	AFDB:O43745	0.734	0.798	3.454E-11	196	0.234	0.255	O43745.pdb.gz	CHP2_HUMAN Calcineurin B homologous protein 2 OS=Homo sapiens OX=9606 GN=CHP2 PE=1 SV=3
5	PDB:2ct9B	0.734	0.788	5.345E-11	198	0.318	0.343	2ct9B.pdb.gz	Structural characterization of calcineurin B homologous protein 1
6	PDB:2becA	0.726	0.851	1.178E-10	181	0.248	0.293	2becA.pdb.gz	Crystal structure of CHP2 complexed with NHE1-cytosolic region and an implication for pH regulation
7	AFDB:Q810D1	0.742	0.806	2.559E-10	196	0.271	0.296	Q810D1.pdb.gz	CHP2_RAT Calcineurin B homologous protein 2 OS=Rattus norvegicus OX=10116 GN=Chp2 PE=1 SV=1
8	AFDB:Q7K107	0.727	0.670	1.707E-9	233	0.290	0.266	Q7K107.pdb.gz	Q7K107_DROME LD19356p (Fragment) OS=Drosophila melanogaster OX=7227 GN=elm PE=2 SV=1
9	AFDB:Q55G87	0.678	0.795	2.743E-9	180	0.215	0.256	Q55G87.pdb.gz	CANB1_DICDI Calcineurin subunit B type 1 OS=Dictyostelium discoideum OX=44689 GN=cnbA PE=1 SV=1
10	AFDB:P63098	0.624	0.768	4.647E-9	170	0.234	0.294	P63098.pdb.gz	CANB1_HUMAN Calcineurin subunit B type 1 OS=Homo sapiens OX=9606 GN=PPP3R1 PE=1 SV=2
11	AFDB:Q9UU93	0.675	0.815	5.163E-9	174	0.229	0.282	Q9UU93.pdb.gz	CANB_SCHPO Calcineurin subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnb1 PE=3 SV=1
12	PDB:6tz8B	0.657	0.790	8.423E-9	174	0.234	0.287	6tz8B.pdb.gz	Harnessing calcineurin-FK506-FKBP12 crystal structures from invasive fungal pathogens to develop antifungal agents.
13	AFDB:J9VL81	0.662	0.792	8.747E-9	175	0.248	0.303	J9VL81.pdb.gz	J9VL81_CRYNH Calcineurin subunit B OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_00888 PE=1 SV=1
14	PDB:7u0tA	0.627	0.699	1.990E-7	190	0.243	0.274	7u0tA.pdb.gz	Structure-Guided Synthesis of FK506 and FK520 Analogs with Increased Selectivity Exhibit In Vivo Therapeutic Efficacy against Cryptococcus.
15	PDB:2zfdA	0.640	0.736	8.707E-7	183	0.192	0.224	2zfdA.pdb.gz	The crystal structure of plant-specific calcium-binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
16	PDB:7ukhI	0.617	0.718	6.121E-6	181	0.168	0.199	7ukhI.pdb.gz	Activation and closed-state inactivation mechanisms of the human voltage-gated K V 4 channel complexes.
17	PDB:6wu5B	0.590	0.675	9.332E-6	183	0.178	0.208	6wu5B.pdb.gz	CIB2 and CIB3 are auxiliary subunits of the mechanotransduction channel of hair cells.
18	PDB:4il1A	0.556	0.240	1.152E-5	529	0.206	0.083	4il1A.pdb.gz	Structural basis of calcineurin activation by calmodulin.
19	PDB:1s1eA	0.583	0.677	1.952E-5	181	0.206	0.243	1s1eA.pdb.gz	Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
20	PDB:1v1fA	0.635	0.711	7.290E-5	188	0.187	0.213	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96BS2	3.02e-161	445	214	1.000	1.000	CHP3_HUMAN Calcineurin B homologous protein 3 OS=Homo sapiens OX=9606 GN=TESC PE=1 SV=3
2	Q9JKL5	9.94e-157	434	214	0.967	0.967	CHP3_MOUSE Calcineurin B homologous protein 3 OS=Mus musculus OX=10090 GN=Tesc PE=1 SV=2
3	A0AVX7	6.31e-116	330	214	0.706	0.706	CHP3_CHICK Calcineurin B homologous protein 3 OS=Gallus gallus OX=9031 GN=TESC PE=2 SV=1
4	Q7K107	1.74e-34	124	233	0.346	0.318	Q7K107_DROME LD19356p (Fragment) OS=Drosophila melanogaster OX=7227 GN=elm PE=2 SV=1
5	Q9VNF9	2.79e-34	122	189	0.332	0.376	Q9VNF9_DROME Ethanol sensitive with low memory, isoform A OS=Drosophila melanogaster OX=7227 GN=elm PE=1 SV=1
6	Q99653	2.81e-29	109	195	0.346	0.379	CHP1_HUMAN Calcineurin B homologous protein 1 OS=Homo sapiens OX=9606 GN=CHP1 PE=1 SV=3
7	P61022	9.12e-29	108	195	0.341	0.374	CHP1_MOUSE Calcineurin B homologous protein 1 OS=Mus musculus OX=10090 GN=Chp1 PE=1 SV=2
8	P61023	9.12e-29	108	195	0.341	0.374	CHP1_RAT Calcineurin B homologous protein 1 OS=Rattus norvegicus OX=10116 GN=Chp1 PE=1 SV=2
9	Q5ZM44	2.79e-26	102	195	0.318	0.349	CHP1_CHICK Calcineurin B homologous protein 1 OS=Gallus gallus OX=9031 GN=CHP1 PE=1 SV=3
10	Q810D1	6.78e-18	80.1	196	0.290	0.316	CHP2_RAT Calcineurin B homologous protein 2 OS=Rattus norvegicus OX=10116 GN=Chp2 PE=1 SV=1
11	O43745	3.91e-17	78.2	196	0.271	0.296	CHP2_HUMAN Calcineurin B homologous protein 2 OS=Homo sapiens OX=9606 GN=CHP2 PE=1 SV=3
12	P63098	5.74e-14	68.9	170	0.252	0.318	CANB1_HUMAN Calcineurin subunit B type 1 OS=Homo sapiens OX=9606 GN=PPP3R1 PE=1 SV=2
13	P63099	5.74e-14	68.9	170	0.252	0.318	CANB1_BOVIN Calcineurin subunit B type 1 OS=Bos taurus OX=9913 GN=PPP3R1 PE=1 SV=2
14	P63100	5.74e-14	68.9	170	0.252	0.318	CANB1_RAT Calcineurin subunit B type 1 OS=Rattus norvegicus OX=10116 GN=Ppp3r1 PE=1 SV=2
15	Q63810	5.74e-14	68.9	170	0.252	0.318	CANB1_MOUSE Calcineurin subunit B type 1 OS=Mus musculus OX=10090 GN=Ppp3r1 PE=1 SV=3
16	Q55G87	7.35e-13	66.2	180	0.210	0.250	CANB1_DICDI Calcineurin subunit B type 1 OS=Dictyostelium discoideum OX=44689 GN=cnbA PE=1 SV=1
17	J9VL81	2.30e-12	65.1	175	0.271	0.331	J9VL81_CRYNH Calcineurin subunit B OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_00888 PE=1 SV=1
18	Q6FLU4	1.02e-11	63.2	175	0.248	0.303	CANB_CANGA Calcineurin subunit B OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CNB1 PE=3 SV=1
19	P25296	1.06e-11	63.2	175	0.252	0.309	CANB_YEAST Calcineurin subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CNB1 PE=1 SV=3
20	Q4QC21	2.12e-10	59.7	175	0.234	0.286	Q4QC21_LEIMA Putative calcineurin B subunit OS=Leishmania major OX=5664 GN=LMJF_21_1630 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	0.00032	31.1	EF hand
2	PF13202 EF-hand_5	1	20.1	EF hand
3	PF13405 EF-hand_6	0.067	24.1	EF-hand domain
4	PF13499 EF-hand_7	9.7e-05	34.1	EF-hand domain pair
5	PF13833 EF-hand_8	1.3e+02	13.8	EF-hand domain pair
6	PF14658 EF-hand_9	1.2e+02	14.4	EF-hand domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000000334

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000011539	0.889	Sodium/hydrogen exchanger
2	61853.ENSNLEP00000018908	0.731	Protein phosphatase 3, catalytic subunit, gamma isozyme
3	61853.ENSNLEP00000020260	0.731	Protein phosphatase 3, catalytic subunit, beta isozyme
4	61853.ENSNLEP00000024305	0.731	Protein phosphatase 3, catalytic subunit, alpha isozyme
5	61853.ENSNLEP00000016669	0.617	N(alpha)-acetyltransferase 10, NatA catalytic subunit
6	61853.ENSNLEP00000005420	0.602	Sodium/hydrogen exchanger
7	61853.ENSNLEP00000002579	0.597	Protein phosphatase 4, catalytic subunit
8	61853.ENSNLEP00000021041	0.591	Protein phosphatase 6, catalytic subunit
9	61853.ENSNLEP00000000938	0.574	Peptidylprolyl isomerase
10	61853.ENSNLEP00000005359	0.574	Peptidylprolyl isomerase
11	61853.ENSNLEP00000011403	0.574	Peptidylprolyl isomerase
12	61853.ENSNLEP00000017871	0.554	Sodium/hydrogen exchanger
13	61853.ENSNLEP00000017882	0.554	Sodium/hydrogen exchanger
14	61853.ENSNLEP00000024261	0.552	Uncharacterized protein
15	61853.ENSNLEP00000021415	0.550	Serine/threonine-protein phosphatase 2A activator
16	61853.ENSNLEP00000009847	0.541	Protein phosphatase 2, catalytic subunit, alpha isozyme
17	61853.ENSNLEP00000014569	0.541	Protein phosphatase 2, catalytic subunit, beta isozyme
18	61853.ENSNLEP00000013952	0.538	Calcium/calmodulin-dependent protein kinase IV
19	61853.ENSNLEP00000003868	0.530	Protein phosphatase 1, catalytic subunit, gamma isozyme
20	61853.ENSNLEP00000007753	0.530	Protein phosphatase 1, catalytic subunit, alpha isozyme

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005509	1.000	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.987	biological regulation
GO:0009987	0.987	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0048518	0.911	positive regulation of biological process
GO:0048522	0.894	positive regulation of cellular process
GO:0019222	0.887	regulation of metabolic process
GO:0032502	0.880	developmental process
GO:0032501	0.856	multicellular organismal process
GO:0048856	0.848	anatomical structure development
GO:0050896	0.807	response to stimulus
GO:0007548	0.787	sex differentiation
GO:0071704	0.783	organic substance metabolic process
GO:0044238	0.776	primary metabolic process
GO:0051239	0.748	regulation of multicellular organismal process
GO:0046661	0.725	male sex differentiation
GO:0030097	0.717	hemopoiesis
GO:0048731	0.694	system development
GO:0061458	0.650	reproductive system development
GO:0060255	0.632	regulation of macromolecule metabolic process
GO:0009893	0.632	positive regulation of metabolic process
GO:0065009	0.611	regulation of molecular function
GO:0051171	0.601	regulation of nitrogen compound metabolic process
GO:0045137	0.598	development of primary sexual characteristics
GO:0034765	0.586	regulation of monoatomic ion transmembrane transport
GO:0031323	0.581	regulation of cellular metabolic process
GO:0006807	0.548	nitrogen compound metabolic process
GO:0050793	0.516	regulation of developmental process
GO:0032409	0.511	regulation of transporter activity
GO:0010604	0.508	positive regulation of macromolecule metabolic process
GO:1904062	0.504	regulation of monoatomic cation transmembrane transport
GO:0010959	0.503	regulation of metal ion transport
GO:0043170	0.497	macromolecule metabolic process
GO:0080090	0.480	regulation of primary metabolic process
GO:0031326	0.480	regulation of cellular biosynthetic process
GO:0010468	0.479	regulation of gene expression
GO:0046546	0.476	development of primary male sexual characteristics
GO:0019538	0.469	protein metabolic process
GO:0030099	0.463	myeloid cell differentiation
GO:0010556	0.462	regulation of macromolecule biosynthetic process
GO:0051716	0.460	cellular response to stimulus
GO:0048519	0.454	negative regulation of biological process
GO:0019219	0.445	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.443	negative regulation of cellular process
GO:0002028	0.436	regulation of sodium ion transport
GO:0006355	0.436	regulation of DNA-templated transcription
GO:0008406	0.427	gonad development
GO:0043270	0.422	positive regulation of monoatomic ion transport
GO:0051240	0.383	positive regulation of multicellular organismal process
GO:0065008	0.376	regulation of biological quality
GO:0032412	0.353	regulation of monoatomic ion transmembrane transporter activity
GO:0031325	0.351	positive regulation of cellular metabolic process
GO:0045595	0.349	regulation of cell differentiation
GO:0031328	0.333	positive regulation of cellular biosynthetic process
GO:0045935	0.325	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.996	nucleus
GO:0016020	0.917	membrane
GO:0070013	0.912	intracellular organelle lumen
GO:0071944	0.889	cell periphery
GO:0031981	0.869	nuclear lumen
GO:0005886	0.866	plasma membrane
GO:0005829	0.853	cytosol
GO:0005654	0.774	nucleoplasm
GO:0042995	0.679	cell projection
GO:0120025	0.642	plasma membrane bounded cell projection
GO:0031252	0.547	cell leading edge
GO:0030027	0.326	lamellipodium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]